[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54205.1


[Show Plain Result]

## Summary of Sequence Search
   1::262
  34::253  PF08889 0.0% 47.6851851851852  WbqC-like protein family 
   1::262


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLDKIDRCDLFVVLDHVQFERKGWQHRN
PF08889         ---------------------------------qPyylPwlgyfqliaaadkfvvlddvqytkkgwrnRn


                         -         -         *         -         -         -         -:140
query           YVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWE
PF08889         riktpqgeqwltvPvkkasrdkkikeveiddsqkwrkkhlktles.ayakapffeevlpllepiyekeee


                         +         -         -         -         -         *         -:210
query           QLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRY
PF08889         sLadlnlklleavceyLgietkivrsseldleeekkterlidickalgattylsgpgareyldeeeFeea


                         -         -         -         +         -         -         -:280
query           GIAVEWQNFQHPEYPQHNRKGQEFLPRMAAIDLLLNVGPEGMDLVRQARIAD------------------
PF08889         gielefqkfrhpeYpqlkk...eFvpnlSilDlLfnvgpealr---------------------------