[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54436.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
  34::303  PF01026 0.0% 41.869918699187  TatD related DNase 
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSVSKSRRQREKRDRARTEPPPLPEPLRVAVPDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
PF01026         ---------------------------------DaHcHldskefeedreeileraeeagvaavvvvgtss


                         -         -         *         -         -         -         -:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATEWEPARPAGGEAALEEALAEIDALAAHEKVCA
PF01026         kdskavlelakkypikvyavlGiHPnevde.......................aneelleeleel.anvk


                         +         -         -         -         -         *         -:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
PF01026         hskvvaiGEiGLDyysreestkeaqeevFeeqlelAkelklplviHtreaeedlleilkeaaeakakvvl


                         -         -         -         +         -         -         -:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDAAAVVPLELLLVETDAPFLTPKPHRGRPNAPYLIPHTLRAL
PF01026         HcfsgseeeakelldlgyyislsglltfknaknlrelvkavpldrlLiETDaPyltpkpyrgkrnepanv


                         -         *         -         -         -         -         +:350
query           AELKGMAEDELAETVAANARRAFALP--------------------------------------------
PF01026         ayvveklaelkgltleevaaita-----------------------------------------------