[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54462.1


[Show Plain Result]

## Summary of Sequence Search
   1::1210
 529::629  PF02559 0.0% 44.2105263157895  CarD-like/TRCF domain 
1058::1142 PF03461 0.0% 38.8235294117647  TRCF domain 
 659::819  PF00270 0.0% 22.972972972973  DEAD/DEAH box helicase 
 893::963  PF00271 0.0% 31.4285714285714  Helicase conserved C-terminal domain 
 660::815  PF04851 0.0% 23.6842105263158  Type III restriction enzyme, res subunit 
   1::1210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPHVLRPLRAGRPSSHAPPGDMSLNGLLSVVTGDPALKRAIETARNGHDPLLDLVAPPSVRPLIVAGLAA
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKRARAL
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AAEYPALADILTKLADGVAVEGMEAFAPVLADRMELLLDLLPPGTHIVGCDPERIRTRAQELVATSQEFL
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EASWINAASGGEAPIDLGASAYQSIAELRSRARELGLPWWTVTPFDPGNPAAAEDDHSVVVGASATDAYR
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GDTERAIADVKSWLHEGWRVVLLTPGQGPAERLASMLRDAGLGTQLRDALPEPPEPAVATVTTGLLEHGF
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VWRSVRTVLLTETDLVGQRSSTRDMRRMPSRRRGVDPLQLKPGDYVVHEQHGIGRYVEMVSRTIQGATRE
PF02559         --------------------------------------elkvGdlVVhpehGvGriegieekevggekre
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWAKAKSRARKAVREIAGDLIRLYS
PF02559         ylvleyae......ndklyvPvenldlisryigseeevpvldkLggkswkkrkaklksgiieiaaellk-
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           ARHASPGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAF
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------tpiQaeaiplile......ggdvlvaaeTGsGKTlaflipvl
PF00271         ----------------------------------------------------------------------
PF04851         -----------------------------pyQeeaienllesiekedekkrglivmaTGtGKTlvaasli


                         -         -         -         -         +         -         -:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         qilyetlpnapkalivaPtreLaeqtlenlkkfkkylklrvlliiggvsardqlsvl.ng.....vdivv
PF00271         ----------------------------------------------------------------------
PF04851         arlar...kflflvprkelleqaleefkkfeskkiefekkniavakkdklfgeeqkkskdkeekkkkdke


                         -         -         *         -         -         -         -:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         gtpgrlddllstgklnlsqvrflvlDEadrllsqgfsddinrilnqlpq---------------------
PF00271         ----------------------------------------------------------------------
PF04851         iilttiqklhkaleeeeendeskseslealldefdviiiDEaHrl-------------------------


                         +         -         -         -         -         *         -:910
query           HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERV
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------ikvailhgelpqnereei
PF04851         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLT
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         leqFnagkskvlvatnvaerGidlpdvnlVinfdl.prsvtsyiQriGRagRa-----------------
PF04851         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           ETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQSAA
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           QEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
PF02559         ----------------------------------------------------------------------
PF03461         -------dlpvdallPeeYiedeeeRlelYkrlaeaeseeeldeieeelidRFGelPeevenLlelarlk
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           VLARSAGLTDVVLQGTQIRFAPVELRESQQLRLRRLYPKAVVKAATRTLMVPVPKSGGLGGKQLRDRELL
PF02559         ----------------------------------------------------------------------
PF03461         llakklgiekikekkkklvitf------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           TWCTELVEAIFEPQRKPPQE--------------------------------------------------
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------