[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54538.1


[Show Plain Result]

## Summary of Sequence Search
   1::490
  36::280  PF00069 0.0% 29.5081967213115  Protein kinase domain 
  40::278  PF07714 0.0% 24.4725738396624  Protein tyrosine kinase 
  55::152  PF01636 0.0% 32.9411764705882  Phosphotransferase enzyme family 
 152::180  PF01636 0.0% 41.3793103448276  Phosphotransferase enzyme family 
   1::490


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRDA
PF00069         -----------------------------------yelleklGsGsfGkVykakkkktgkkvAvKilkke
PF07714         ---------------------------------------kklGeGafGkVvegtlkgekekkevkVavKt
PF01636         ------------------------------------------------------tgag.ryvlrr.....
PF01636         ------------------------------------------------------tgag.ryvlrr.....


                         -         -         *         -         -         -         -:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
PF00069         eeksk.kektavrElkilkklsHpnivkllevfeekdelylvleyveggdlfdllkkegklseeeikkia
PF07714         lkekaeeee..keefleeakimkklkhenivkllgvctkeepllivteyvkgGdLlefLrkkekekltlk
PF01636         .arparaaeelrrevallrlLakagipvPevlagdtdddvlgllfalleyvpgevler......klnarq
PF01636         .arparaaeelrrevallrlLakagipvPevlagdtdddvlgllfalleyvpgevler......klnarq


                         +         -         -         -         -         *         -:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
PF00069         lqilegleylHsngiiHrDLKpeNiLldkkgelkiaDFGlakkleksseklttlvgtreYmAPEvllkak
PF07714         dllkfalqiAkGmeyLeskklvHrdLaarNvLleeekvvkisDfGLardiekddyykkkeeaklpvkWma
PF01636         lpallealaelpvllHgDlhpgNllvdpddgrvGviDfed------------------------------
PF01636         lpallealaelpvllHgDlhpgNllvdpddgrvGviDfed------------------------------


                         -         -         -         +         -         -         -:280
query           PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETL
PF00069         eytkkvDvWslGvilyelltgklpfsgeseedqleliekilkkkleedepkssskseelkdlikkllekd
PF07714         pEslkekkftsksDvWsfGvllwEiftlgespypglsneevlellkegkrlekpekcpeelyelmkqC--
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSNVAAQPSPTP
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PPHPQTASGPQPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPPPGPHQHAYPTPHSGNAAIPPH
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEGTSTAFVLGVVSIAVIAGVLLFILLFLLIGSLG
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------