[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54591.1


[Show Plain Result]

## Summary of Sequence Search
   1::553
  14::179  PF02776 0.0% 37.5757575757576  Thiamine pyrophosphate enzyme, N-terminal TPP bindi 
 460::529  PF02776 0.0% 32.7586206896552  Thiamine pyrophosphate enzyme, N-terminal TPP bindi 
 138::170  PF02775 0.0% 25  Thiamine pyrophosphate enzyme, C-terminal TPP bindi 
 391::538  PF02775 0.0% 29.9319727891156  Thiamine pyrophosphate enzyme, C-terminal TPP bindi 
 199::330  PF00205 0.0% 36.9230769230769  Thiamine pyrophosphate enzyme, central domain 
   1::553


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
PF02776         -------------gaealvraLkalgvehvfgvpgssilplldalaked.girlvlarhEqgaafaAdgy
PF02776         -------------gaealvraLkalgvehvfgvpgssilplldalaked.girlvlarhEqgaafaAdgy
PF02775         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
PF02776         aratgkpgvvlvtsgpGatnaltglaeAyvdriPvlvlsgqvptselgqgvlqqeldqaalfrpvtkyaa
PF02776         aratgkpgvvlvtsgpGatnaltglaeAyvdriPvlvlsgqvptselgqgvlqqeldqaalfrpvtkyaa
PF02775         -------------------------------------------------------------------gar
PF02775         -------------------------------------------------------------------gar
PF00205         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAE
PF02776         rvtspeelpealrrAlrtalsgrpgPvylelprdvleee-------------------------------
PF02776         rvtspeelpealrrAlrtalsgrpgPvylelprdvleee-------------------------------
PF02775         vekaeeleealkeal.....ekkgpaliev----------------------------------------
PF02775         vekaeeleealkeal.....ekkgpaliev----------------------------------------
PF00205         ----------------------------------------------------------ideaaellkaak


                         -         -         -         +         -         -         -:280
query           RPVLVYGSDVWLDHAEQAALEAAEELGVPVVTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLD
PF02776         ----------------------------------------------------------------------
PF02776         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         rPvilvGggvrrseakeelralaeklgipvvttlmgkgvipedhplslgylgllgspaaneaieeaDlvl


                         -         *         -         -         -         -         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRTEVAEA
PF02776         ----------------------------------------------------------------------
PF02776         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         vlGarlsdvrttg..psakfapaakiihvdidpaeigknypvdvavvgdi--------------------


                         -         -         -         -         *         -         -:420
query           AAATAAKDREVLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYAGKYIQPRRPGNWLDPGPFGCL
PF02776         ----------------------------------------------------------------------
PF02776         ----------------------------------------------------------------------
PF02775         ----------------------------------------diGchtlwaarl.kvkrprsyltsgglgtm
PF02775         ----------------------------------------diGchtlwaarl.kvkrprsyltsgglgtm
PF00205         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
PF02776         ---------------------------------------vdriPvlvlsgqvptselgqgvlqqel..dq
PF02776         ---------------------------------------vdriPvlvlsgqvptselgqgvlqqel..dq
PF02775         GyglpaAiGaklakpdrevvaivGDGgflmilqelatavrrnlpitvvvlnNegygmtggqqepfggkrk
PF02775         GyglpaAiGaklakpdrevvaivGDGgflmilqelatavrrnlpitvvvlnNegygmtggqqepfggkrk
PF00205         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV-------
PF02776         aalfrpvtky..........aarvtspeelpealrrAlr-------------------------------
PF02776         aalfrpvtky..........aarvtspeelpealrrAlr-------------------------------
PF02775         sgpdgkklkpvdfaklaealGakgarvekaeeleealkealekkgpal----------------------
PF02775         sgpdgkklkpvdfaklaealGakgarvekaeeleealkealekkgpal----------------------
PF00205         ----------------------------------------------------------------------