[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54627.1


[Show Plain Result]

## Summary of Sequence Search
   1::258
  30::214  PF02361 0.0% 27.6243093922652  Cobalt transport protein 
   1::258


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNLTSAPAGRAAPGNGQPGVRSWLLGINPAAKLIAACVISFGLIPAVDPVTGGIVLAVTALLLPFSGINR
PF02361         -----------------------------rtklvillllvllvflpigfvflsvifllvlfvfliaklp.


                         -         -         *         -         -         -         -:140
query           ATLLVLSVPFCLMGLSTWVVNLLYGEEGLWGASGAAVRILAIALPGMLAAVSSDATDLADALVQRLKVPE
PF02361         ..saiksitlllllllfvlwfifllfgnyqdnvfsgvfvfnrgnlylirswGllravllalrvttlilil


                         +         -         -         -         -         *         -:210
query           RPAMGVLAALRLVPLLADQWRTVTLARRARGLEAGRNPLAALSIFFGKLFALLVRAVRTGTLLATAMDAR
PF02361         llLtlTTssvelasgl.erllvPlnelamtlalalRfiplLleelqrilnAqasRgldfrkggflekmrs


                         -         -         -         +         -         -         -:280
query           AFGTGPRSHARVSRWRLADTVLVAASLLLLAAAYTVSAQLGTLRLLFT----------------------
PF02361         lssl------------------------------------------------------------------