[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54630.1


[Show Plain Result]

## Summary of Sequence Search
   1::603
  20::266  PF00069 0.0% 26.9387755102041  Protein kinase domain 
  21::266  PF07714 0.0% 21.7213114754098  Protein tyrosine kinase 
  34::136  PF01636 0.0% 27.4725274725275  Phosphotransferase enzyme family 
 138::163  PF01636 0.0% 38.4615384615385  Phosphotransferase enzyme family 
 438::594  PF00689 0.0% 23.6842105263158  Cation transporting ATPase, C-terminus 
   1::603


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
PF00069         -------------------yelleklGsGsfGkVykakkkktgkkvAvKilkkeeekskkektavr.Elk
PF07714         --------------------elgkklGeGafGkVvegtlkgekekkevkVavKtlkekaeeee..keefl
PF01636         ---------------------------------tyrvttga.gryvlrrarpa.....raaeelrreval
PF01636         ---------------------------------tyrvttga.gryvlrrarpa.....raaeelrreval
PF00689         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIH
PF00069         ilkklsHpnivkllevfeekdelylvleyveggdlfdllkkegklseeeikkialqilegleylHsngii
PF07714         eeakimkklkhenivkllgvctkeepllivteyvkgGdLlefLrkkekekltlkdllkfalqiAkGmeyL
PF01636         lrlLakagipvPevlagdtdddvlgllfalleyvpgevler......klnarqlpallealaella-llH
PF01636         lrlLakagipvPevlagdtdddvlgllfalleyvpgevler......klnarqlpallealaella-llH
PF00689         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFA
PF00069         HrDLKpeNiLldkkgelkiaDFGlakkl.eksseklttlvgtreYmAPEvllkakeytkkvDvWslGvil
PF07714         eskklvHrdLaarNvLleeekvvkisDfGLardiekddyykkkeeaklpvkWmapEslkekkftsksDvW
PF01636         gDlhpgNllvdpddgrvGviDfe-----------------------------------------------
PF01636         gDlhpgNllvdpddgrvGviDfe-----------------------------------------------
PF00689         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ATGNPPYGAGAFEVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMED
PF00069         yelltgklpfsgeseedqleliekilkkkleedepkssskseelkdlikkllekdp--------------
PF07714         sfGvllwEiftlgespypglsneevlellkegkrlekpekcpeelyelmkqCweee--------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EYRSSGMTGLHTVSADLPTSTPQPAPPEPEENQATAVAEAAAPDRTMVAPEGFGDDEEEQDSGRRYDHYY
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DATLRPEEFRDILTPVDYEGRNRDSADYDDEPPSLLERFRAYRRGEDRLSDYFSDDEDDYYDEYEAKRLP
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           WVMVVPVALGIVGLTLMMPTIGLILGTLAVTVLGGLDLARREHARRLHERGPRSSDNVVIALSMPWALLR
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         -----------------lsaiqiLwinLvtDglpalaLaleppekdimkrkPrkkkeplfskkm...llr


                         *         -         -         -         -         +         -:560
query           TLGHAALYGLGYLLAGIVVGIAIGMVSGNSSANVVGSWALGVVVLMNFLFGPHARGAQRQSRWLVSKITI
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         iliqgllqalvtllafflgllgfgisekenklsasnfaqtaaFitlvlsqifnalnlrs.rreslfkfsg


                         -         -         -         *         -         -         -:630
query           RNPYVYWGTIIAISLLALFLVVFGVQLVPAWDPIPGPSEWFGS---------------------------
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF00689         if.snkllllavllslllqvlivyvpglnavfgt------------------------------------