[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54828.1


[Show Plain Result]

## Summary of Sequence Search
   1::125
   1::116  PF04020 0.0% 43.9252336448598  Membrane protein of unknown function 
   1::125


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVGCIFYYVTLGL
PF04020         lrfllrllvnavallvvakllpgvevsg......flaaliaalvlgllnalvkpilkllslpltiltlGl


                         -         -         *         -         -         -         -:140
query           VALVVNALLLWLTAWLAGVLGIPFEIDGFWAAFWGAIIVAIVSWLLSLFVGKDDD---------------
PF04020         ftlvinalllllaawlved...gfkvdgfwsAllgaivisivsavv------------------------