[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54978.1


[Show Plain Result]

## Summary of Sequence Search
   1::1077
  92::342  PF08376 0.0% 28.0334728033473  Nitrate and nitrite sensing 
 564::669  PF02518 0.0% 27.6190476190476  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
 360::443  PF00672 0.0% 33.3333333333333  HAMP domain 
   1::1077


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTRATNNGADAKDDAPEQAEKTETTAKRPARRWDPRNWRVRSRLVALVVVPTAAALILGVVRFSESALN
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TFRNERTEAMVTLAEDIVQLGNELGKERMLVAAYIADNPNPTRRSNDRAVALQEQQKIVDQELNDVRAGA
PF08376         ---------------------heLQkERglsagflaskgtrf......rdalkaqraatDkalaalrsal
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTMLPAVTKYRQIISTLTDFVETLANATNTSSEL
PF08376         aeldadaseaelaerlasvlaaldqLpalReqvdslsisaaeavafYtrlisallalvdelaqsa.ddae
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RESVRALSALGRARDDQSYEAALMVHSLIRDSMSGGVQDSIESTQARYNNEIRNFRNSATPAQEALLDEN
PF08376         larqlaalvallqakEraGqeRallaaafaagkfteelyqrlasliaeqeaylerfaafaspeqralyeq
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YGGLDVSRLGTMRLRALLRADEGQPLTGITDGDDADSYQQTALSALDTLAKVESSLARMVRAEATAHKEQ
PF08376         llaspavkeverlrqqalaaaa.....ggglsgvdaeeWfeastaridllkevedrllddla--------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GRRLLLFDSITVLFVVVFVFLTTSWVARSMVIPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ---------vvlllalllalvlawllarrilrPlrrLaeaarriaeGdld..................dr


                         -         -         +         -         -         -         -:490
query           LEVDSSDEFGEVARSFDEVHRSALRLAADEAALRANVNAMFVNLSRRSQSLVERQLRLIEHLEQSEQDEE
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         vpvdgrdEigeLarafnamlerL-----------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSEVEQYARVNVRAPSHVSVLGR
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
PF08376         ----------------------------------------------------------------------
PF02518         ---rlrqivselvdNavkateesgeievrvkree.gelvieVeDnGiGipeedlervfepffqtdddsrk
PF00672         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPNDLLITPVEPTPPALTSGRGTTVPDTYAEATA
PF08376         ----------------------------------------------------------------------
PF02518         vggtGlGlsivkklvellggeieveskeggGttvtlrlp-------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AFASSPAPADPADSVWEPRTSNDRPVWEPRTTPSGLPKRPDPATRAAQQGQQTPPEHPPSGEDLWDAGWK
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           RSVSRTTSPQPVADRPETPRTETPRPETPRPETPRTETPRTESPADTTSTSAIPTVSDSRPSAADTVGSS
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RTGGQSVYGYSLDRPGQRSAHPLGDTRSSTSERQGWQQNPLSSSYSSGSGRTEQPEVREGYGSTAYLSKR
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           YGPGSGNQNTIIPPSPEHESNEPLPIFDSIESNWFRRRTVRPAVTTTETGPISAVSTPDGLGTEPAAPAQ
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           QQSQQPRPEDEWRSAADAGWKTAAERASAPIAGGITASGLPKRIPRANLVPGAAPAPENFKQITSRSAER
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           VRSRFSSFQQGIRQGRDALNKRSSQEE-------------------------------------------
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------