[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55004.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
  20::219  PF01596 0.0% 40.7035175879397  O-methyltransferase 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
PF01596         -------------------sveesellkeLreatakk.pglsamqvspeegqfLsllvklvgakkvleiG


                         -         -         *         -         -         -         -:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
PF01596         vftGyslLatalalPedGkiiaidideeaaeigkkfiqkagvedkielilgdalkvLeelvedkkqgefD


                         +         -         -         -         -         *         -:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
PF01596         lifvDaDkssYknyyeklleLvkvGgliaiDntLweGkvaeeddeepetvavlelnkklaeDeRveisll


                         -         -         -         +         -         -         -:280
query           DGFTLARRR-------------------------------------------------------------
PF01596         pvgDGitla-------------------------------------------------------------