[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55025.1


[Show Plain Result]

## Summary of Sequence Search
   1::107
   1::94   PF00893 0.0% 45.1612903225806  Small Multidrug Resistance protein 
  30::99   PF03151 0.0% 20  Triose-phosphate Transporter family 
  33::100  PF00892 0.0% 25.7575757575758  EamA-like transporter family 
   1::107


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAYGIWSALGVTL
PF00893         mnwvllviAillevigailLklsegftklipsllvivgygisfllLskalks.lpvsvaYavwsGiGtvl
PF03151         -----------------------------yvlllllngvlafllnisaflllervSsltlsvagivkrvl
PF00892         --------------------------------llgllgtvlgyllffyalkkt..sasnaslitslePvf


                         -         -         *         -         -         -         -:140
query           VAVIGAVFLGDTLTWVQIVGIVLVIAGVAALELGAAR---------------------------------
PF00893         ttlvgillfgeslslkkliglali----------------------------------------------
PF03151         vivlsviifgdkitflnilGlliallGvv-----------------------------------------
PF00892         tillsvlllgekltlkqllgivlillGvll----------------------------------------