[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55030.1


[Show Plain Result]

## Summary of Sequence Search
   1::236
  64::170  PF03099 0.0% 32.6732673267327  Biotin/lipoate A/B protein ligase family 
   1::236


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
PF03099         ---------------------------------------------------------------leeggvv


                         -         -         *         -         -         -         -:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
PF03099         varrqtgGrrvwhspggnlaysllllpelksfklsdleayvlllvlavlealgelg......pgetgipv


                         +         -         -         -         -         *         -:210
query           RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
PF03099         kikwpnDllvngkKiaGilvesrrgatlhh----------------------------------------


                         -         -         -         +         -         -         -:280
query           HLAAVLGASSYRRIAGWPVLPEFVDA--------------------------------------------
PF03099         ----------------------------------------------------------------------