[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55194.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
   6::240  PF00977 0.0% 55.1111111111111  Histidine biosynthesis protein 
  34::118  PF01207 0.0% 33.3333333333333  Dihydrouridine synthase (Dus) 
 158::231  PF01207 0.0% 27.027027027027  Dihydrouridine synthase (Dus) 
  62::122  PF01180 0.0% 29.5081967213115  Dihydroorotate dehydrogenase 
 191::249  PF01180 0.0% 28.8135593220339  Dihydroorotate dehydrogenase 
  36::119  PF05690 0.0% 24.0963855421687  Thiazole biosynthesis protein ThiG 
 184::232  PF05690 0.0% 30.6122448979592  Thiazole biosynthesis protein ThiG 
  60::106  PF03060 0.0% 27.6595744680851  2-nitropropane dioxygenase 
 149::234  PF03060 0.0% 25.5813953488372  2-nitropropane dioxygenase 
  41::237  PF01070 0.0% 22.7642276422764  FMN-dependent dehydrogenase 
  61::110  PF01884 0.0% 29.7872340425532  PcrB family 
 184::233  PF01884 0.0% 26  PcrB family 
  61::104  PF02581 0.0% 32.5581395348837  Thiamine monophosphate synthase/TENI 
 164::229  PF02581 0.0% 33.8461538461538  Thiamine monophosphate synthase/TENI 
  64::101  PF00478 0.0% 28.9473684210526  IMP dehydrogenase / GMP reductase domain 
 197::234  PF00478 0.0% 39.4736842105263  IMP dehydrogenase / GMP reductase domain 
  54::110  PF00290 0.0% 26.3157894736842  Tryptophan synthase alpha chain 
 192::232  PF00290 0.0% 26.8292682926829  Tryptophan synthase alpha chain 
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
PF00977         -----riipalDlkdgkvVrlvkGdrfknlryagdpvelakkyeeegadelhvvDLdaakegreanldlv
PF01207         ---------------------------------lelarrveaaGaqaltvHgRtraqnyegtadweaIke
PF01207         ---------------------------------lelarrveaaGaqaltvHgRtraqnyegtadweaIke
PF01180         -------------------------------------------------------------ialkvirel
PF01180         -------------------------------------------------------------ialkvirel
PF05690         -----------------------------------lakrleevGcaavmPlaapiGsgkGlknkenlkii
PF05690         -----------------------------------lakrleevGcaavmPlaapiGsgkGlknkenlkii
PF03060         -----------------------------------------------------------vgtllllvetv
PF03060         -----------------------------------------------------------vgtllllvetv
PF01070         ----------------------------------------ekkkksagasealvraqldpaltwedlewl
PF01884         ------------------------------------------------------------eevikvkkvl
PF01884         ------------------------------------------------------------eevikvkkvl
PF02581         ------------------------------------------------------------plgleglkel
PF02581         ------------------------------------------------------------plgleglkel
PF00478         ---------------------------------------------------------------iemikki
PF00478         ---------------------------------------------------------------iemikki
PF00290         -----------------------------------------------------TGarealeeevkelver
PF00290         -----------------------------------------------------TGarealeeevkelver


                         -         -         *         -         -         -         -:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
PF00977         eeiaeevfiplqvGgGIrsledveelleagadkviigtaavknpelikelaekfgsqkivvaiDakk...
PF01207         vkqavsipviaNGdikdaedaqailaetGadgvMigrgalgnPwlfae----------------------
PF01207         vkqavsipviaNGdikdaedaqailaetGadgvMigrgalgnPwlfae----------------------
PF01180         ykrlkkeipiIgvGGiesgeDalekieaGAslvqvytalvfegpkiakkikk------------------
PF01180         ykrlkkeipiIgvGGiesgeDalekieaGAslvqvytalvfegpkiakkikk------------------
PF05690         ieeakvPvivDAGigtpsdaaqamelGadavllnta.vaeakdpvamAr---------------------
PF05690         ieeakvPvivDAGigtpsdaaqamelGadavllnta.vaeakdpvamAr---------------------
PF03060         kdavdiPviAAGGiadgrgiaaaLalGaeGVqiGTr----------------------------------
PF03060         kdavdiPviAAGGiadgrgiaaaLalGaeGVqiGTr----------------------------------
PF01070         reetklplvlK.GvltaedakraveaGvdgivVSNHGGRq..............................
PF01884         ed...arlivGGGiksaEkAkelvkaGADvivvGnvveek------------------------------
PF01884         ed...arlivGGGiksaEkAkelvkaGADvivvGnvveek------------------------------
PF02581         aealeiPvvaiGGit.lenvaevleagadgvAvv------------------------------------
PF02581         aealeiPvvaiGGit.lenvaevleagadgvAvv------------------------------------
PF00478         keklpeleviaGNvvtaeaaeeLieagadav---------------------------------------
PF00478         keklpeleviaGNvvtaeaaeeLieagadav---------------------------------------
PF00290         vkkltavpvavGFGistpeqvkkvaekvadGvivGSalvd------------------------------
PF00290         vkkltavpvavGFGistpeqvkkvaekvadGvivGSalvd------------------------------


                         +         -         -         -         -         *         -:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
PF00977         g.......kvaikgwreetgldavelakkleelgageilltdidrdGtlsGpdlellkklaeavkipvia
PF01207         -----------------enalelarrveaaGaqaltvHgRtraqnyegtadweaIkevkqavsipviaNG
PF01207         -----------------enalelarrveaaGaqaltvHgRtraqnyegtadweaIkevkqavsipviaNG
PF01180         --------------------------------------------------lkvirelykrlkkeipiIgv
PF01180         --------------------------------------------------lkvirelykrlkkeipiIgv
PF05690         -------------------------------------------GsgkGlknkenlkiiieeakvPvivDA
PF05690         -------------------------------------------GsgkGlknkenlkiiieeakvPvivDA
PF03060         --------esgvkviplvssakearkaaaagaDalvaqGteaGGhrgevgtllllvetvkdavdiPviAA
PF03060         --------esgvkviplvssakearkaaaagaDalvaqGteaGGhrgevgtllllvetvkdavdiPviAA
PF01070         .........................................lDgapatid..vLpeiveavagrlevllD
PF01884         -------------------------------------------GaledvpeevikvkkvledarlivGGG
PF01884         -------------------------------------------GaledvpeevikvkkvledarlivGGG
PF02581         -----------------------aeeaealgadYiglGpifpTdtKkdaeplgleglkelaealeiPvva
PF02581         -----------------------aeeaealgadYiglGpifpTdtKkdaeplgleglkelaealeiPvva
PF00478         --------------------------------------------------------aakklgvpviaDGG
PF00478         --------------------------------------------------------aakklgvpviaDGG
PF00290         ---------------------------------------------------elvervkkltavpvavGFG
PF00290         ---------------------------------------------------elvervkkltavpvavGFG


                         -         -         -         +         -         -         -:280
query           AGAVEHFAPAVDAGANAVLAASVFHFGEITISDVKAELRAKGYPVR------------------------
PF00977         sGGvgsledlkelksegvdavlvgsalheg----------------------------------------
PF01207         dikdaedaqailaetGadgvM-------------------------------------------------
PF01207         dikdaedaqailaetGadgvM-------------------------------------------------
PF01180         GGiesgeDalekieaGAslvqvytalvfegpkiakkikk-------------------------------
PF01180         GGiesgeDalekieaGAslvqvytalvfegpkiakkikk-------------------------------
PF05690         GigtpsdaaqamelGadavlln------------------------------------------------
PF05690         GigtpsdaaqamelGadavlln------------------------------------------------
PF03060         GGiadgrgiaaaLalGaeGVqiGT----------------------------------------------
PF03060         GGiadgrgiaaaLalGaeGVqiGT----------------------------------------------
PF01070         gGirrGsDvlkalAlGAdavlvGRpfl-------------------------------------------
PF01884         iksaEkAkelvkaGADvivvGnv-----------------------------------------------
PF01884         iksaEkAkelvkaGADvivvGnv-----------------------------------------------
PF02581         iGGitl.envaevleagad---------------------------------------------------
PF02581         iGGitl.envaevleagad---------------------------------------------------
PF00478         irnsgdiakAlaaGAsavMlGsll----------------------------------------------
PF00478         irnsgdiakAlaaGAsavMlGsll----------------------------------------------
PF00290         istpeqvkkvaekvadGvivGS------------------------------------------------
PF00290         istpeqvkkvaekvadGvivGS------------------------------------------------