[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55274.1


[Show Plain Result]

## Summary of Sequence Search
   1::227
  23::165  PF03358 0.0% 36.4285714285714  NADPH-dependent FMN reductase 
  24::117  PF02525 0.0% 23.9130434782609  Flavodoxin-like fold 
   1::227


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISRTGRPTAGHAEGSRREPPLRLVVVVASARKGRNGGCVAQWFLEQTTGRSELEVDTVDTAVFPLPPEP
PF03358         ----------------------kilvisGslrkgsntrklaewaaealaea.gaevelidladlilp.lc
PF02525         -----------------------iLiinahprpeksfssalaqafvealeeagphevtvrdLyadflpvl


                         -         -         *         -         -         -         -:140
query           HRDPDPTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
PF03358         dedlee.esddlqellekiaaadgviivtPeYngsypgllKnalDrlskkelrgKpvalvavgggraggl
PF02525         ttrdlalayeekp.adveseq.iekllaadvivlqfPlwwfgvPail-----------------------


                         +         -         -         -         -         *         -:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEACAVAAQNLLDQLVWWGRALRRAREESPYRG
PF03358         raeealrpvlaelgavvvprgvvav---------------------------------------------
PF02525         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SARDIRSQMIEEPQYVR-----------------------------------------------------
PF03358         ----------------------------------------------------------------------
PF02525         ----------------------------------------------------------------------