[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55328.1


[Show Plain Result]

## Summary of Sequence Search
   1::392
  66::371  PF01094 0.0% 21.523178807947  Receptor family ligand binding region 
   1::392


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNMRKSWSRTLLAATGATALLAAAACGTNEAGESSSTGEGLPDTIKIMSIKEMTGPVSFAGENSTKGIDL
PF01094         -----------------------------------------------------------------eAmel


                         -         -         *         -         -         -         -:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
PF01094         AieeiNadgsllpgitlgaeiddtcsddsfavaaaacllksrgvvaviGpscssvsdavarlanlfniPq


                         +         -         -         -         -         *         -:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
PF01094         isygatspelsdsknryptfaRtvpsdtkqaqaivdiikhfgWnkvallyddddy..gegglealeeelr


                         -         -         -         +         -         -         -:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
PF01094         eaglncvakvsekisndsdaeellkelkdikskarvivlfcssedarqilqaavelgmnsgeyvwilsdl


                         -         *         -         -         -         -         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
PF01094         wsdslldelnekaeeaaegvlgftl..vspnspgfreflerlkklanqneteasdeeisafallvyDaVy


                         -         -         -         -         *         -         -:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVTLGDD----------------------------
PF01094         llahAlnkllredpdqtrglk-------------------------------------------------