[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55333.1


[Show Plain Result]

## Summary of Sequence Search
   1::500
  20::413  PF07690 0.0% 27.6967930029155  Major Facilitator Superfamily 
  26::120  PF00083 0.0% 29.4736842105263  Sugar (and other) transporter 
 139::185  PF00083 0.0% 25.531914893617  Sugar (and other) transporter 
 309::422  PF00083 0.0% 22.1238938053097  Sugar (and other) transporter 
  36::249  PF06609 0.0% 25.3521126760563  Fungal trichothecene efflux pump (TRI12) 
   1::500


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAATPAAVPHISPLRVIVPLVLGGLTYAMSQNAIVPVLAEIQRATGSTASEAAWVVTGFFISSAVLTVIA
PF07690         -------------------lllaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasll
PF00083         -------------------------tltlikfaknfglltsksakeessvlsglivssflvgaliGslfa
PF00083         -------------------------tltlikfaknfglltsksakeessvlsglivssflvgaliGslfa
PF00083         -------------------------tltlikfaknfglltsksakeessvlsglivssflvgaliGslfa
PF06609         -----------------------------------salpnilqdvgqsen.sslfstlwttgqavsilvm


                         -         -         *         -         -         -         -:140
query           GRLGDLFGRKPVLLISLGLFALGGLIAAAGGTLGAVVAGRVIMGVAGGVFPLAFALLGQLLPRDRAAFGM
PF07690         aGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeerg
PF00083         glladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgv------------------ls
PF00083         glladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgv------------------ls
PF00083         glladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgv------------------ls
PF06609         grltdrfgrrpfvilthilglvgaivgctatkfntllaamtllgvaagpagasplfvgelmsnktkflgl


                         +         -         -         -         -         *         -:210
query           GLVSSMLGLGGALGLPVGGLVAEYFGYQGLFWGSAAMAAGSVVAIALLVPEPRRRGRGRVDWIGATLLTF
PF07690         ralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeel..
PF00083         glivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq-------------------------
PF00083         glivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq-------------------------
PF00083         glivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq-------------------------
PF06609         livsipvvvtsglspylgqrlaiqgswrwifyiyiitsaiavllivvwyyppsfaqlhgkkvrkreelak


                         -         -         -         +         -         -         -:280
query           SLTTGLLAVSRGAEWGWSSTPVLALAAVGVIGLVVLLGVERRIPDPLIDLRLMRQRNVWLAHVIGFLTTC
PF07690         ...........................................rkepaplvpawklllkppvlw..llia
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ldwigiilvivgvslfllgvswggkpnspwnsakvigli-------------------------------


                         -         *         -         -         -         -         +:350
query           GQITTFLLVPQMVQAPAEGGTGLGVGVTQAGLYLLPFSMTTLVGGALTGKAVARFGIRPLMALGAASAVT
PF07690         lllfffvfsglltllplylqevlglsp....glllaglllgllaligaigalllgrlsdrlgrrrrllla
PF00083         ----------------------------lsglivssflvgaliGslfaglladrfGRkksllvalvlfvi
PF00083         ----------------------------lsglivssflvgaliGslfaglladrfGRkksllvalvlfvi
PF00083         ----------------------------lsglivssflvgaliGslfaglladrfGRkksllvalvlfvi
PF06609         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GLSILAFLPVQPATVLLGAGITGIGGGTIYSALPVLIAEAVPERETGTVNGINTIIRTIAMAILSQVTTV
PF07690         llllllaalglallaftssavwllvvlvliGfglglvfptllalasdlappeerGtasglfnt-------
PF00083         gavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlaitvGi.lvaaii
PF00083         gavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlaitvGi.lvaaii
PF00083         gavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlaitvGi.lvaaii
PF06609         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VLVVGTPPGQDYPLRAAFTVDFSMSALLNLLALLLVPCIVVAGARRGRGGGKADAHPKAAAVRREEPAAE
PF07690         ----------------------------------------------------------------------
PF00083         gl--------------------------------------------------------------------
PF00083         gl--------------------------------------------------------------------
PF00083         gl--------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ESEQRSWPPS------------------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------