[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55377.1


[Show Plain Result]

## Summary of Sequence Search
   1::1060
 326::475  PF05729 0.0% 22.6950354609929  NACHT domain 
 626::656  PF05729 0.0% 19.3548387096774  NACHT domain 
   1::1060


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKTLSYTDALRILGGEDGSSLGELGEALTKGTLSALGVPDVLGLHDRLIRHGQNAITGIREKLTGVSRW
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DRTERVAAADLILRITAFFNALAELLEQHHCPFTLRDLRFTRNEQYRLFSDVLRGIEQDTPTLPPASGGP
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ELATPYRKAAGVLLLFLRGLEVWDRLDDAERTRVTETLEELPSRACRRHIELYRKLAADVPEFGVWANFS
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AHEKTQEQITEISTGLDELAQILQKLTTSRSRRRLTELENLYQAILDKPILDASEAPNGVVLPSVRDAYL
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DLGGLLRFTDENATPSSEAWWHEATRYDNLQPLLASLLTQRECLLRPIVLLGHPGAGKSQLTRMLAARLP
PF05729         ---------------------------------------------rtvilqGeaGsGKTtLlqklasawa
PF05729         ---------------------------------------------rtvilqGeaGsGKTtLlqklasawa


                         -         -         -         -         *         -         -:420
query           LGNFLPLRVELRSVPADAPIHTQIDEGISATLHARTSWRDLADEAQDALPVVILDGFDELLQATGVNRSD
PF05729         kgklpqdafklvFflslrelsrskna.rsladlLfsqlpepaapvsevwivllelperlL..lilDglDe
PF05729         kgklpqdafklvFflslrelsrskna.rsladlLfsqlpepaapvsevwivllelperlL..lilDglDe


                         -         -         +         -         -         -         -:490
query           YLEQVQRFQEHQADLGRPVAVIVTSRTVVAERTRFPFGIPVIRLEPFTDAQIAHLTDVWNRANTAALAER
PF05729         lvsdlgq......kekqpvrtlLselirkkllpeasllltvrpdavrdleeqlee---------------
PF05729         lvsdlgq......kekqpvrtlLselirkkllpeasllltvrpdavrdleeqlee---------------


                         *         -         -         -         -         +         -:560
query           GLHPITADSLLRYRDLAEQPLLLFMLLIFDADANALQRETADLGRAGLYEKLLTSFAEREVRKHHPHLYG
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EELAQAVEDELRSLEVVAIAMFARHQQWVSAEQLEADLAALFPGAGVHAEETGLSGHITTSHQVLGRFFF
PF05729         -----------------------------------------------------------------fklvF
PF05729         -----------------------------------------------------------------fklvF


                         -         +         -         -         -         -         *:700
query           VHEARAIQQGDTRSVYEFLHATFGEHLVARAVVNELARLVEDRAYYARRRAPLPENSDFLFYAFTSFAAL
PF05729         flslrelsrsknarsladlLfsqlpe--------------------------------------------
PF05729         flslrelsrsknarsladlLfsqlpe--------------------------------------------


                         -         -         -         -         +         -         -:770
query           AGRAAIVESAAELLAVKAADARERAAYRSLLVDMFREAPYPRPFPKRDYQPFKATITHRLAAYTANLVTL
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LVLIADEIDLSELFPDSGPPWLPWRELVGTWRSLPGDDWYGLLDTVRMRHLGHWGEDETPRALLCREQRT
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           PVNVGECVGFELRVNASGRLEITNPYRLTVPYPNETSRMLRSVSLLMQGWSARLVLMVGPYLEHGGSTIG
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TWAMEEAVYSDPDEEEAEDAHLPIPVSWMPSSDILELRLGPCGVPETAASRLFRYQRILEWSLSRGFVLG
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           RHEWAALRQAGEELAAIQDATTDPVFREVYQNLRVIIEAHLHRVEKVMPKRKLLEPVLETLRPHLNDPSV
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           IDRVLDLATS------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------