[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55524.1


[Show Plain Result]

## Summary of Sequence Search
   1::656
  12::345  PF00724 0.0% 31.8885448916409  NADH:flavin oxidoreductase / NADH oxidase family 
 392::429  PF00070 0.0% 50  Pyridine nucleotide-disulphide oxidoreductase 
 530::584  PF00070 0.0% 20  Pyridine nucleotide-disulphide oxidoreductase 
 392::496  PF07992 0.0% 33.9805825242718  Pyridine nucleotide-disulphide oxidoreductase 
 566::616  PF07992 0.0% 22.2222222222222  Pyridine nucleotide-disulphide oxidoreductase 
 189::348  PF01207 0.0% 24.1379310344828  Dihydrouridine synthase (Dus) 
 392::432  PF03486 0.0% 39.0243902439024  HI0933-like protein 
 393::432  PF00890 0.0% 37.5  FAD binding domain 
 568::626  PF00890 0.0% 29.3103448275862  FAD binding domain 
 393::429  PF01210 0.0% 54.0540540540541  NAD-dependent glycerol-3-phosphate dehydrogenase N- 
 393::424  PF01494 0.0% 53.125  FAD binding domain 
 393::427  PF01266 0.0% 41.1764705882353  FAD dependent oxidoreductase 
   1::656


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIAYWAARARAGLAWVGGISA
PF00724         -----------LFkPikignltLknRivmapmtrlras..edgtvpedllveyysqRakggvtli..ite
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
PF00724         avavs....pksg.gfenqpglyddeqve.qwkklteavhengskvvvqlwhlGreakaeyredaedgps
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
PF00724         dpvaleasekvagnel.keltkeeIkeiikefveAAkrAveAgfDgVeihgahgYLldqFlspksNkrtD
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         ------------------------------------------------PakkvtkggaGaaLlrkpdlva
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
PF00724         eyGGSlenRaRFllevveavkeavgedrpvglRlspdevvekgktlaetaqkiellkelgkrvkdgkrla
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         qivkavvkaveipvtvkirigid......dskenalelarrveaaG.aqaltvHgR.......traqnye
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
PF00724         lielaeprktkafsveveqevknaekikkvvkipvitvGrindpevaaeiveegkadlvaigRef-----
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         gtadweaIk.evkqavsipviaNGdikdaedaqailaetGadgvMigrgalgnPwlfaestavktgea--
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
PF00724         ----------------------------------------------------------------------
PF00070         -----------------------------------------rvvvvGgGyiGlElAaalaklgkkVtvie
PF00070         -----------------------------------------rvvvvGgGyiGlElAaalaklgkkVtvie
PF07992         -----------------------------------------dvviIGgGpaGlaaakrlarlglkvalie
PF07992         -----------------------------------------dvviIGgGpaGlaaakrlarlglkvalie
PF01207         ----------------------------------------------------------------------
PF03486         -----------------------------------------dviviGgGaAGlmaAisaakrgakVllld
PF00890         ------------------------------------------vvViGsGlAGlaAAleaaeaglkvavve
PF00890         ------------------------------------------vvViGsGlAGlaAAleaaeaglkvavve
PF01210         ------------------------------------------vavlGaGswGtalAkvlaenghevrlWv
PF01494         ------------------------------------------VlIVGaGpaGlmlallLseaGvrvvlve
PF01266         ------------------------------------------vviiGgGivGlstAyeLarrglkVtlle


                         -         -         +         -         -         -         -:490
query           REEQLGGQMRIAARAAENAAYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFDADVVAVATGAVPRRLP
PF00724         ----------------------------------------------------------------------
PF00070         rrdrllral-------------------------------------------------------------
PF00070         rrdrllral-------------------------------------------------------------
PF07992         re..pggtclnrgcipkkllleaaeeeeldlkeleerkdegievllntgvtdidkakkkveladgkaevk
PF07992         re..pggtclnrgcipkkllleaaeeeeldlkeleerkdegievllntgvtdidkakkkveladgkaevk
PF01207         ----------------------------------------------------------------------
PF03486         kakklgrKilis----------------------------------------------------------
PF00890         keqetggataws----------------------------------------------------------
PF00890         keqetggataws----------------------------------------------------------
PF01210         reeklieei-------------------------------------------------------------
PF01494         khst------------------------------------------------------------------
PF01266         kg.dias---------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIG
PF00724         ----------------------------------------------------------------------
PF00070         ---------------------------------------lAaalaklgkkVtvierrdrllraldeeiak
PF00070         ---------------------------------------lAaalaklgkkVtvierrdrllraldeeiak
PF07992         ydklvi----------------------------------------------------------------
PF07992         ydklvi----------------------------------------------------------------
PF01207         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           APLAKLTAAGAAFTFMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGGVPDDSLYHELKRHGKANV
PF00724         ----------------------------------------------------------------------
PF00070         ilqkklekngievllntkveeieg----------------------------------------------
PF00070         ilqkklekngievllntkveeieg----------------------------------------------
PF07992         -----rkdegievllntgvtdidkakkkvel......adgkaevkydklviAtGak--------------
PF07992         -----rkdegievllntgvtdidkakkkvel......adgkaevkydklviAtGak--------------
PF01207         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         -------eagkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvlatgGfgrd.rra----
PF00890         -------eagkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvlatgGfgrd.rra----
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           HLLGDAYAPRRITFATQQAYALAALV--------------------------------------------
PF00724         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01207         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------