[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55595.1


[Show Plain Result]

## Summary of Sequence Search
   1::253
  93::172  PF00005 0.0% 36.7647058823529  ABC transporter 
  45::81   PF00684 0.0% 29.7297297297297  DnaJ central domain (4 repeats) 
   1::253


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
PF00005         ----------------------------------------------------------------------
PF00684         --------------------------------------------kkvktCkkCnGsGvvvkeqrapggvv


                         -         -         *         -         -         -         -:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVREAEEFFRAGEARLPAAHAILTRLADVGLGYLSLGQP
PF00005         ----------------------ltvrenldmakeekk...........tdkrieevlekvglde.lldks
PF00684         qsqqtCeaCkG-----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGLHLADVAQLLALLDRIVDSGKSVIVIEHHQAVMAHAD
PF00005         rvstLSgGqkqrvalArallkkpklllLDEPt--------------------------------------
PF00684         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WIIDLGPGAGHEGGRVVFEGTPAELVAARSTLTGQHLADYVGA---------------------------
PF00005         ----------------------------------------------------------------------
PF00684         ----------------------------------------------------------------------