[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55605.1


[Show Plain Result]

## Summary of Sequence Search
   1::323
  38::222  PF01758 0.0% 27.6243093922652  Sodium Bile acid symporter family 
 238::309  PF01758 0.0% 23.943661971831  Sodium Bile acid symporter family 
   1::323


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLAERLQSLFVALAALTGLATGLLLPIGPTAAHAVLPALILMLTAVFLQMNFARLGEARHATRLVTTSL
PF01758         -------------------------------------llLflmmfpmglkvevedlkellkrpkalllgl
PF01758         -------------------------------------llLflmmfpmglkvevedlkellkrpkalllgl


                         -         -         *         -         -         -         -:140
query           ILNFAVTPALAWTLGAGLLTTHPDLRIGLLLLLVTPCTDWYLVFTALAHGHTGLATALLPVNLLLQLALL
PF01758         vlqwvikPllmfilailllrllpelavGliLvglapggamsnvwtylakGdlelsvvlvalstllallva
PF01758         vlqwvikPllmfilailllrllpelavGliLvglapggamsnvwtylakGdlelsvvlvalstllallva


                         +         -         -         -         -         *         -:210
query           PGYVLLLGGNAAMVDATTLTESVLLVLALPLTTALGLRWIATRLKGAHWRHRFLTTPASRLVLPLLYAAV
PF01758         pllslllagslldvgavsileliksvliyviiPliaGiltryilp....rekfekkllkvlspisligll
PF01758         pllslllagslldvgavsileliksvliyviiPliaGiltryilp....rekfekkllkvlspisligll


                         -         -         -         +         -         -         -:280
query           FAMFAGQARTVVTHAPDLIALLPPLAIFFTALPATATATARILRLPPDQRVTLVMTTTARNSPTALAIAV
PF01758         ltivvifalkge---------------qwvikPllmfilailllrllpelavGliLvglapggamsnvwt
PF01758         ltivvifalkge---------------qwvikPllmfilailllrllpelavGliLvglapggamsnvwt


                         -         *         -         -         -         -         +:350
query           AAFPDRPLIAVALVIGPLLEIPVLTLLTQLVRIRPPHTTSSPR---------------------------
PF01758         ylakGdlel.svvlvalstllallvapll-----------------------------------------
PF01758         ylakGdlel.svvlvalstllallvapll-----------------------------------------