[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55679.1


[Show Plain Result]

## Summary of Sequence Search
   1::854
  53::846  PF01804 0.0% 38.9901823281907  Penicillin amidase 
   1::854


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVSVPRVRRWLLGILAAVLAVALITAGLAVWTVRRSFPQVSGELELPALSAPVTVYRDEYGITHLYADT
PF01804         ----------------------------------------------------sveIvrdayGvpHIyAdd


                         -         -         *         -         -         -         -:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
PF01804         ehdlyfalGYvqAqdrlfqlellrrtarGelaevlGadalstDrfvrtlglpdtaeaqyaalsakdrall


                         +         -         -         -         -         *         -:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLAR
PF01804         eaYadGvNaYle.rsgnplplefallgvk.....pepwkpvdvlavaelllweltagtr.eikna.lllq


                         -         -         -         +         -         -         -:280
query           GLPREQVEELYPAYPEEQHAPILAGGRVRDGKFVLDSDEAEQRDEDAADIPATAAVRALAGLQEPLEAIP
PF01804         kleekygaeitalypalllr...............asaakaailrslgslqd..........aa.laeaa


                         -         *         -         -         -         -         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
PF01804         ellaaesang...igSNawavagerTanGkalLandPhlpweapsvwyevqLsapg......fdvtGasl


                         -         -         -         -         *         -         -:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
PF01804         pGlPgvviGhNqtvAWgaTvsgadvvdlYaeklnpkdprqYlydGewrpmekrketiavkgadpvevtvy


                         -         -         +         -         -         -         -:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
PF01804         rTkhGPVvaraggg.........................kaaialrrsglgeedesldaflklnrAktva


                         *         -         -         -         -         +         -:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
PF01804         qfeaaaaaqaipslNvvyADaeGnigyvvagrvPvrrpnangllPvpg.dgsydwkglipfsalPkllnP


                         -         -         -         *         -         -         -:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVEVDVEGA
PF01804         qqGyvvnaNnrpvapdyplslggeflepglRadrilellggkas...ltledmkalqldasldsladlll


                         -         +         -         -         -         -         *:700
query           AAQAQELLAGWDFQQDADSAAAAFYNATYRHLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGE
PF01804         pllleaarknaadlsaeaavaaLaawdgkadadseaaalfkawlralareafadelpaeglatplatlap


                         -         -         -         -         +         -         -:770
query           EVSSRDEALRVAMERAAAELTELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSS
PF01804         vtdadslniaadtpvlaatnq.naaaavaealaaalavleaklgdspsswewGevhr.lrptralgisa.


                         -         -         *         -         -         -         -:840
query           VVNATGWDPAQGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS
PF01804         ......lnvggfpaaGdentvnasslarggengavlgesarrvvdfadssnsrgvlpggqsgnpaSphya


                         +         -         -         -         -         *         -:910
query           AVEEAAEHTLVLRP--------------------------------------------------------
PF01804         Dqlelw----------------------------------------------------------------