[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55697.1


[Show Plain Result]

## Summary of Sequence Search
   1::243
  46::170  PF00005 0.0% 30.0884955752212  ABC transporter 
  36::53   PF02463 0.0% 50  RecF/RecN/SMC N terminal domain 
 124::200  PF02463 0.0% 28.5714285714286  RecF/RecN/SMC N terminal domain 
  22::77   PF03308 0.0% 28.5714285714286  ArgK protein 
   1::243


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP
PF00005         ---------------------------------------------STLlklltgelkptegeievdndrk
PF02463         -----------------------------------aivGpNGSGKsnvldAil-----------------
PF02463         -----------------------------------aivGpNGSGKsnvldAil-----------------
PF03308         ---------------------lrkilpkaGralvvGltGvPGaGkstlveklikelrrrGkrvavlavDP


                         -         -         *         -         -         -         -:140
query           AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG
PF00005         dlesdkleklr.igyipqdpllf..peltvrenldmakeekk.........tdkrieevlekvgldelld
PF02463         -----------------------------------------------------ellesagiske......
PF02463         -----------------------------------------------------ellesagiske......
PF03308         sspftGG---------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE
PF00005         ksrvstLSgGqkqrvalArallkkpklllL----------------------------------------
PF02463         lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfiv----------
PF02463         lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfiv----------
PF03308         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AILLHRRVLAHGSPDRVLVPELMLRAFGLEEPA-------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03308         ----------------------------------------------------------------------