[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55755.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
   6::386  PF06187 0.0% 64.8293963254593  Protein of unknown function (DUF993) 
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSLTLRLPTPTGELETYTVLGTPVTPTRTTPARSRVAYAAAHVVADPLGSNGPGQPAQLDWDATLAFRH
PF06187         -----lkLPkadgsleeyelkgeelaakkeapatsrvayaaahvvadpladndpvaeaavdWdatlafrr


                         -         -         *         -         -         -         -:140
query           YLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGVGTDHLEPSQATLESVIKAYRE
PF06187         elwslGlgvaeamdtaqrGmGldWaaakeLirrslaeakavgaevacGagtdhlapseaaelddvieaye


                         +         -         -         -         -         *         -:210
query           QLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLADVDRPVILHWLGAVFDPALDGYWGYTDPAEA
PF06187         eqlevveeaggrvilmasraLarvakspddyakvyervlaqveepvilhWLGdmfdpaLagyWGsedlea


                         -         -         -         +         -         -         -:280
query           IDAVAALIADHADRVDGIKVSLLDDTLEVRLRTLLPDGVRLYTGDDFNYPDLILGDADGHSHALLGIFAA
PF06187         aletvlelieenadkvdGikvsLLdkekevalrrrlpegvrlytGddfnyaeLiaGdekgysdaLLGifd


                         -         *         -         -         -         -         +:350
query           IAPAAAEALRALDDGDTDRYRALLAPTVPLSRHLFAAPTYYYKTGITFVAWLNGHQKGFSMVGGLQSARD
PF06187         aiapaasaalealdagdaeefrelleptvpLsrkifkaPtqyyktGvvflayLngkqkhftmvgGlesar


                         -         -         -         -         *         -         -:420
query           LPHLATAFRLADAAGVLTDPETAVSRMRTLLTVYGVDQ--------------------------------
PF06187         sllhlaelfrladqagllkdPelavarmkellavaG----------------------------------