[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55822.1


[Show Plain Result]

## Summary of Sequence Search
   1::239
  98::220  PF07729 0.0% 35.7723577235772  FCD domain 
   7::69   PF00392 0.0% 41.2698412698413  Bacterial regulatory proteins, gntR family 
   1::239


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSESLADRLADRLLDQVVRGELAVDEALPSEAEIAAAADVSRLTVREAVKVLRTKNIVRVKRGRGTYVN
PF07729         ----------------------------------------------------------------------
PF00392         ------yeqvyeeLredIlsgelrpGdkLPsereLaaefgVsrttvReALrrLeaeglverrqgrGtfV-


                         -         -         *         -         -         -         -:140
query           APEHWTDLELILRMAQRRSGAGAAALGLLEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADD
PF07729         ---------------------------lyelRelLEgeaarlaarratdadlaelralleemeaaaaegd
PF00392         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAA
PF07729         leefaeadlaFHralaeaagnprlaellerlrarlrrlrrlslsapgrleevlaeHraildAirarDaea
PF00392         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ARDAMRAHFDQLAEDLLRHVVDRCGVSEP-----------------------------------------
PF07729         AraamrrHle------------------------------------------------------------
PF00392         ----------------------------------------------------------------------