[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55880.1


[Show Plain Result]

## Summary of Sequence Search
   1::252
  59::181  PF00005 0.0% 38.7931034482759  ABC transporter 
  45::222  PF02463 0.0% 23.5632183908046  RecF/RecN/SMC N terminal domain 
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKSTLMHCMAGLDT
PF00005         ----------------------------------------------------------STLlklltgelk
PF02463         --------------------------------------------ksftaivGpNGSGKsnvldAilFvLG


                         -         -         *         -         -         -         -:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
PF00005         ptegeievd.ndrkdlesdkleklr...igyipqdpllfpeltvrenldmakeekk...tdkrieevlek
PF02463         eksakklrseklsdlihkskskakvksaeveitfdnedkelvieeeevsitrrvkrkge.seykingkev


                         +         -         -         -         -         *         -:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTGNLDSRSGAEVLSFLRDSVRELGQTIVMV
PF00005         vgldelldksrvstLSgGqkqrvalArallkkpklllLDEP-----------------------------
PF02463         tk.kevaellesagiskelLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeks


                         -         -         -         +         -         -         -:280
query           THDPIAASYADRVVFLRDGRVVDDVTHPTPQLILDRLAGLEG----------------------------
PF00005         ----------------------------------------------------------------------
PF02463         kn.aQfivi.sl----------------------------------------------------------