[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55924.1


[Show Plain Result]

## Summary of Sequence Search
   1::707
  13::99   PF02922 0.0% 46.8354430379747  Carbohydrate-binding module 48 (Isoamylase N-termin 
 193::532  PF00128 0.0% 21.8518518518519  Alpha amylase, catalytic domain 
   1::707


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
PF02922         ------------plGahydaegagvtfrvwapnAtrVelvlyfnnswdaeeapmkrkreggvWevflpgd
PF00128         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
PF02922         lkegvyYkyrvtgpn....g....pnkll-----------------------------------------
PF00128         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------YlkdlGvtaiwlsPife.


                         -         -         -         +         -         -         -:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
PF02922         ----------------------------------------------------------------------
PF00128         .........spqsyhgYditdykkidpef...Gt....ledfkeLiskahekgikvilDlVvNHtsdehe


                         -         *         -         -         -         -         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
PF02922         ----------------------------------------------------------------------
PF00128         wfkeslkskdnpyrdyyiwkdgkkepptnwkslfggsaweddeeaqehkflkslpdlnteneevvkelkk


                         -         -         -         -         *         -         -:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
PF02922         ----------------------------------------------------------------------
PF00128         vvkfwl.dkgvDGfRlDavkhisk............................................ef


                         -         -         +         -         -         -         -:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
PF02922         ----------------------------------------------------------------------
PF00128         wkeftqalneyk....eevftvgEvfgasdedarvdatesymeleslldfedfdlaekvkeksqlksita


                         *         -         -         -         -         +         -:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLL
PF02922         ----------------------------------------------------------------------
PF00128         kklkevlsktlselsedeeqvtflenHDqeR....vlsrfgd----------------------------


                         -         -         -         *         -         -         -:630
query           DFVRTLSRLRREHPVFRRRRFFQGALPGRGKQRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPD
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKG
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           VTKALPS---------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------