[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ55991.1


[Show Plain Result]

## Summary of Sequence Search
   1::252
  31::222  PF01955 0.0% 38.8888888888889  Adenosylcobinamide amidohydrolase 
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDTETIGDGTLLTAHLRWRRDNGRALAAVLWQCGPGWRMAASSVLGGGLGPRDYVINAQVDGDYRRTDPD
PF01955         ------------------------------vrfeeprrvlssavlngGlrevravlnhqvpkdfddedpe


                         -         -         *         -         -         -         -:140
query           NHLEELATHFGMTGTGVGLLTAANVSEACFADDHGVEVLATVGLGRPTWAAADPALDEARLPGEETRPGT
PF01955         eylkevlerlgleeedtvgllTAvdmenlaiaeeefedlsvtavvTaGvsnavragaka.edeask....


                         +         -         -         -         -         *         -:210
query           INIVVAVPAPMSDTALVNLVATATEAKVQALFDSGYACTGTASDAVCVAALVGDTPPAQRELFGGVRSRW
PF01955         ...gTINiivlinarLsdaAlveaiitatEAKtaalqelgirskksqatGTgTDavavas....gesgee


                         -         -         -         +         -         -         -:280
query           GGRVARAVYAAVAEGARREAARSQQRSPHRAAAYSPSMMSGT----------------------------
PF01955         leyaGkhtelGe----------------------------------------------------------