[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56010.1


[Show Plain Result]

## Summary of Sequence Search
   1::389
  30::232  PF00563 0.0% 29.7979797979798  EAL domain 
   1::389


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGRSGDHGAVSPQTSFSDDTRVGVLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
PF00563         -----------------------------elslvfQPivdlstgkvvgyEallrwkhpeggvispeeflp


                         -         -         *         -         -         -         -:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
PF00563         laerlgliaeldrlllekalaqlaelakkasldpdlklsvnlspasllsde.fleqllell.eaglparr


                         +         -         -         -         -         *         -:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
PF00563         lvlEisesdl..deslellealarLrslGirlalddfgtgysslsrlaelppdviKidrsllkdls.dpe


                         -         -         -         +         -         -         -:280
query           IAQLTALRTVGVRMAQGPLFAGDDWAPGDRVTQIPALSLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEE
PF00563         arallkalialarelgikviae------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VLEAFSADSALNSVILLDHRERPVAALDRARFLLSITGPYGHALYAKRPAQKLADPPRTVPLTAPALAAL
PF00563         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RIAGTDQDRVYDDLIAVNEFGQCRGVVHISDIIRGLSAR-------------------------------
PF00563         ----------------------------------------------------------------------