[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56050.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
 160::314  PF02800 0.0% 69.0322580645161  Glyceraldehyde 3-phosphate dehydrogenase, C-termina 
   3::154  PF00044 0.0% 61.744966442953  Glyceraldehyde 3-phosphate dehydrogenase, NAD bindi 
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
PF02800         ----------------------------------------------------------------------
PF00044         --ikvgInGfGriGrlvlrall..kqedlevvaindlagdletlayllkydsvhgrfkgeveveeekliv


                         -         -         *         -         -         -         -:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
PF02800         ----------------------------------------------------------------------
PF00044         ngkkikvlaerdpeelpwkelgvdlVvesTGvftskekaekhlkagakkVvisapakdeaaktivvgvNe


                         +         -         -         -         -         *         -:210
query           YDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
PF02800         -------------------aplakvlndkfgiekglmttvhaytadQklvDgpskdlrraraaaeniipt
PF00044         eeydpee.kivsna--------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTKEEVNAAFKAAAEGALKDILVYTED
PF02800         stgaakavgkVlpelkgkltgmAlrVPtpdvsvvdlvvelekkvtveevnaalkeaaegalkgilsytee
PF00044         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWYDNEWGYSNRLVDLVKLVGSNL---------------
PF02800         elvssDfvgdphssifdaketivlnenlvkvvaw------------------------------------
PF00044         ----------------------------------------------------------------------