[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56054.1


[Show Plain Result]

## Summary of Sequence Search
   1::656
 395::572  PF08459 0.0% 56.2913907284768  UvrC Helix-hairpin-helix N-terminal 
 210::241  PF02151 0.0% 46.875  UvrB/uvrC motif 
  18::94   PF01541 0.0% 27.2727272727273  GIY-YIG catalytic domain 
 588::604  PF00633 0.0% 41.1764705882353  Helix-hairpin-helix motif 
 609::636  PF00633 0.0% 32.1428571428571  Helix-hairpin-helix motif 
 364::401  PF01367 0.0% 28.9473684210526  5'-3' exonuclease, C-terminal SAM fold 
 591::615  PF01367 0.0% 32  5'-3' exonuclease, C-terminal SAM fold 
 620::642  PF01367 0.0% 43.4782608695652  5'-3' exonuclease, C-terminal SAM fold 
   1::656


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
PF08459         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------
PF01541         -----------------wgvYiivnkknkvlYiGstnnlerRlkeHnagkesketkqkkygkdkfeltiv
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
PF08459         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------
PF01541         eeirtkqealelEkelikkynpnk----------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAEDFCAFMAGETGRF
PF08459         ----------------------------------------------------------------------
PF02151         ---------------------------------------------------------------------l
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LRQLEAEMKQAAAAQEYERAARIRDDIQALRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGR
PF08459         ----------------------------------------------------------------------
PF02151         lkeLeeemeeAaeeedFEkAAklRDqinale---------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVD
PF08459         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKALAEIAEALGLAEAPLRIECFDISTLQGEH
PF08459         --------------------------------------------lkelleleelpkriecfDiShiqged
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         -------------enilenldklkkkklrekleaakeeaklskkLatlktd-------------------
PF01367         -------------enilenldklkkkklrekleaakeeaklskkLatlktd-------------------
PF01367         -------------enilenldklkkkklrekleaakeeaklskkLatlktd-------------------


                         -         -         +         -         -         -         -:490
query           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
PF08459         tvasmvvfedgkpkkseYRkykikeiteg.dDyasmrevltrrfkrlleeea..................
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
PF08459         .......klPdLiliDGGkgqlnaakevleelgle.ipvvglaKkeeektkklllpgekeelklkknsea
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT
PF08459         llllqrirdeah----------------------------------------------------------
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         ---------------------------LlalPGVGpktAeaIls----leglipasreeLlalPGVGpkt
PF00633         ---------------------------LlalPGVGpktAeaIls----leglipasreeLlalPGVGpkt
PF01367         ------------------------------vkgiGektAakLLkeygslenilen----ipGvkgiGekt
PF01367         ------------------------------vkgiGektAakLLkeygslenilen----ipGvkgiGekt
PF01367         ------------------------------vkgiGektAakLLkeygslenilen----ipGvkgiGekt


                         -         +         -         -         -         -         *:700
query           AQTIYERLTSVEGGQRTQPENSKADE--------------------------------------------
PF08459         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF00633         AeaIls----------------------------------------------------------------
PF00633         AeaIls----------------------------------------------------------------
PF01367         AakLLkeygsle----------------------------------------------------------
PF01367         AakLLkeygsle----------------------------------------------------------
PF01367         AakLLkeygsle----------------------------------------------------------