[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56082.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
   9::99   PF03259 0.0% 33.3333333333333  Roadblock/LC7 domain 
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNASENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLARGTSRQFKGG
PF03259         --------aeellellqrvpgvrgalvvskdGlvlas.stldnddadrlAalasgllaaakalarelgeg


                         -         -         *         -         -         -         -:140
query           RVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVGQFLTSAPRHPEAAGRVSTGS
PF03259         elkelliegkkgelyltpagegalLvvla-----------------------------------------