[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56085.1


[Show Plain Result]

## Summary of Sequence Search
   1::399
   6::393  PF00764 0.0% 56.9587628865979  Arginosuccinate synthase 
   1::399


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
PF00764         -----vLaysGGlDtsviikllkeklgeeviavavdvGqeeedldeaeekalklgavksvvvDakeeFvk


                         -         -         *         -         -         -         -:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
PF00764         dyifpaikanalYedrYllstalaRPliakklvevakkegaeavahGctGkGnDqvRFevsirslaPdlk


                         +         -         -         -         -         *         -:210
query           VLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYDYTQNPAE
PF00764         viaPvReleltReeeieyakekgipvpvtkkkpysiDenllgrsieagiLedpkteppediyeltkdpak


                         -         -         -         +         -         -         -:280
query           PREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLI
PF00764         akdepeeveieFekGvPvsldgeklevlelikklnelagkhGvGRiDivedRlvglksReiYeapaalvL


                         -         *         -         -         -         -         +:350
query           TAHQELENVTVERELARFKRWVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVT
PF00764         ikahkdleeltlerevlkfkeiveekyaelvYkGlwlsPlkealdafidktqervtGtvrvklykGsvvv


                         -         -         -         -         *         -         -:420
query           GRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIANMRDRRLS---------------------
PF00764         lgReselslYdeelvsfdeedeldqkeaeGfvkihglqaklye---------------------------