[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56165.1


[Show Plain Result]

## Summary of Sequence Search
   1::167
  33::162  PF00484 0.0% 30.2325581395349  Carbonic anhydrase 
   1::167


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNGVFDDVLAANEDYVRTFTLAGLQPVAARGLALVTCMDSRIEPLEMLGLKPGDAKILRNAGARVTDDTL
PF00484         --------------------------------lvigCsDsRvppelifglgpGdlfvvRnagnlvppydd


                         -         -         *         -         -         -         -:140
query           RTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLEFHTDSDQIGALHRDVERIRH
PF00484         svlasleyAvevlkveeivVlgHsdCGavkaallsalkewleeirpaleeakeeeedaverera.eeenV


                         +         -         -         -         -         *         -:210
query           HPLLPPDLPVMGAIYDVDTGRVTPVDM-------------------------------------------
PF00484         keqvenLrthplvreavekgrl------------------------------------------------