[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56191.1


[Show Plain Result]

## Summary of Sequence Search
   1::515
  30::449  PF00501 0.0% 37.6847290640394  AMP-binding enzyme 
   1::515


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
PF00501         -----------------------------YreldervnrlaagLrklGvkpgdrVaillpnspewviafl


                         -         -         *         -         -         -         -:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
PF00501         aclkaGavyvpvyptlpaerlayilndseakvlitddelltklkeaaskelakealiivr.....sepae


                         +         -         -         -         -         *         -:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
PF00501         ....svgeeellleleslkkasteppkvplkpddlayiiyTSGtTGkPKgVmlthrnllalvagiakrvg


                         -         -         -         +         -         -         -:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
PF00501         lkpdd..rvlsllp.lafdgsvleilgplllGatlvlvspedlkdpalllddiekykvtvlalvptllel


                         -         *         -         -         -         -         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
PF00501         llkapek..kkldlsslrlilsggeplspellrrlreafggipivngYGltEttvivtvslpgdeetkpg


                         -         -         -         -         *         -         -:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
PF00501         siGrplpgveikivdeegkevppgevGEllirgpsvakGYlkdpeltaeafvedgwklyrTGDlgrided


                         -         -         +         -         -         -         -:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK
PF00501         GyleiiGRkkdqvkirGeriepgeiEsvl-----------------------------------------


                         *         -         -         -         -         +         -:560
query           YPRIVEFRTELPMTATGKILKRELR---------------------------------------------
PF00501         ----------------------------------------------------------------------