[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56286.1


[Show Plain Result]

## Summary of Sequence Search
   1::430
  43::375  PF00155 0.0% 28.0254777070064  Aminotransferase class I and II 
  49::195  PF01212 0.0% 23.0215827338129  Beta-eliminating lyase 
   1::430


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
PF00155         ------------------------------------------aekegalaggtlneygpidglpeleeal
PF01212         ------------------------------------------------Gde.aYgedktvarledavael


                         -         -         *         -         -         -         -:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
PF00155         akflgrseklklkreaavvvgsGagaliealifllklnpgdeilvpdptyasyknilrlsggevvryply
PF01212         lgkeaalf.....vpsGtaAnqialsallqreeevvvtepshihfdetgaikelggvklvtlknkea..g


                         +         -         -         -         -         *         -:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
PF00155         seedfhldlealeealkeapegnkktkvvlvesphNPtGtvatleeleklldlakkynlllfvDeaYagf
PF01212         kldleklealikevgaheenialisltitnntaGGqvvsleelreiaeiakeygi---------------


                         -         -         -         +         -         -         -:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
PF00155         vfgsldavatranveeepnllivgslsKafGlaGeRvGyilgna.....avvsqlrklsrpfls..ssll
PF01212         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PAEIVDLVARSRRLHGLVARAVAERFRAAGVPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
PF00155         qaavaaalsdallkqseleemrqrlqkrrkelrdeLaelglkvlasqsgmflltdlsae...........
PF01212         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISEVLDEVRQEQ
PF00155         takelskkLleevgvyvtpgtsftv---------------------------------------------
PF01212         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PAVAVPAMAS------------------------------------------------------------
PF00155         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------