[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56387.1


[Show Plain Result]

## Summary of Sequence Search
   1::134
   7::124  PF00903 0.0% 27.027027027027  Glyoxalase/Bleomycin resistance protein/Dioxygenase 
   1::134


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRKIFVNVAVQDLQKSQEFFTALGFRFDPRFTDTNAACMVINDDCAVMLLTRDFFRRFTRKELVDAAKN
PF00903         ------valavgdleksldFYtkvLGfklvkktdnteeteglriaffhaggghielvlneapsgaakhvk


                         -         -         *         -         -         -         -:140
query           TESIISVSADRKEEVDELVNRAFEAGARPSIDPIENEGMYAWGFQDLDGHLWEVVWMDPRALEA------
PF00903         kiee.......tvhhvafialdvedvgkaldrlkeagvkvvaepgrhyfgalys----------------