[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56411.1


[Show Plain Result]

## Summary of Sequence Search
   1::407
  64::163  PF06030 0.0% 21  Bacterial protein of unknown function (DUF916) 
   1::407


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAIRSSRIARLGVVGLLLYALTTPAPALADPSPDNNSAPSPAARAEQDFRWSVAPSNENGELGRSYFVH
PF06030         ---------------------------------------------------------------kasYFdL


                         -         -         *         -         -         -         -:140
query           DVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFALLPADEEPALAGTWIEIPREDQTVEVKGGE
PF06030         kvkpkqtqtlkvkikNktnkeikvkvkvnnalTndnGvieYsknkkkkdkslkyklsdlvkvpkeevtvp


                         +         -         -         -         -         *         -:210
query           TRVIPFTITVPDNAEPGDHAAGVIASVSHDALNAQGQLVRVDRRIAARVYLRVDGPVRPSLHIDAIRTDY
PF06030         anesktvtvkvkmPkksfkGvil-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           QAPPWWNPFATGEVTITYQVRNAGNLRLTASGEAGAAGPFGVGLGDPVHKDVPEMLPGTVYEYTHTIPDI
PF06030         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YPLFWINGEVTLTPQAAPQSAQTPDLHPVTRGDSVIAIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVAA
PF06030         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AVAEARKQDAAHQGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQTEPEEPRS-------------
PF06030         ----------------------------------------------------------------------