[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56417.1


[Show Plain Result]

## Summary of Sequence Search
   1::284
  72::195  PF00005 0.0% 30.7017543859649  ABC transporter 
  59::75   PF02463 0.0% 58.8235294117647  RecF/RecN/SMC N terminal domain 
 166::231  PF02463 0.0% 34.8484848484849  RecF/RecN/SMC N terminal domain 
  45::89   PF03193 0.0% 29.5454545454545  Protein of unknown function, DUF258 
   1::284


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRIRQTMRAVVHGSGLRRLTPPQRVTSGTVVLGARHLSKSYGARTVLDDVSLDVRTGEVLALVGPNGAG
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------sftaivGpNGSG
PF02463         ----------------------------------------------------------sftaivGpNGSG
PF03193         --------------------------------------------kegleelaellkd.ktsvlvGqSGvG


                         -         -         *         -         -         -         -:140
query           KSTLLSILTGDTPPDRGEVTVLDRPLAAWSPAELALRRAVLPQSFTVSFPFDVVDVVHMGRAPWAAVDVD
PF00005         -STLlklltgelkptegeievd.ndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk..
PF02463         Ksnvl-----------------------------------------------------------------
PF02463         Ksnvl-----------------------------------------------------------------
PF03193         KSsLinallpeldlkvgev---------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDDDRVVADAMAATEVTALAARKFPSLSGGEKARVMLARVLAQQTQIMLWDEPTAALDIRHQESVLRIAR
PF00005         .....tdkrieevlekvgldelldksrvstLSgGqkqrvalArallkkpklllLD---------------
PF02463         -------------------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskva
PF02463         -------------------------lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskva
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QRAAQGDAIVVVLHDLALAAAYADQVAILSQGQIAAYGPPAEVFTAKLLSDVYSYEVEIVSHPRTGVPLV
PF00005         ----------------------------------------------------------------------
PF02463         ellkeksknaQfivislreem-------------------------------------------------
PF02463         ellkeksknaQfivislreem-------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LPVR------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------