[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56459.1


[Show Plain Result]

## Summary of Sequence Search
   1::416
 313::416  PF05746 0.0% 38.4615384615385  DALR anticodon binding domain 
  43::123  PF03485 0.0% 25.6410256410256  Arginyl tRNA synthetase N terminal domain 
   1::416


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEADRGRDTFAVLPGTPHIRPCTGAHMAMTALSFAAATPRYLSDLIRHACTEATGIPAAHLPDAPLRRS
PF05746         ----------------------------------------------------------------------
PF03485         ------------------------------------------lkkaiaealska...ldleveeavietp


                         -         -         *         -         -         -         -:140
query           TDQPGQYLSPLPSRLAGRLGRAARDLAADITAVLRNQPHLTDVQVTGPGFVAVTPVPSMRAALAQLVADA
PF05746         ----------------------------------------------------------------------
PF03485         kdpefGDyatnvamrlakklkknPreiAeeiaekleeseliekveiagpGFiN-----------------


                         +         -         -         -         -         *         -:210
query           PAAFLLDLAVPGVAHQPGPPPDGWALSDLAHARDSGQLRDWARADARRRIAAAADPATAPAAAAALTRQP
PF05746         ----------------------------------------------------------------------
PF03485         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PADWRDVPQDNTATEAAQLLTVIGEAAARVAACRSAADQVRPQETTGPDLPARPSPHAPGAWARATAANP
PF05746         ----------------------------------------------------------------------
PF03485         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AFALRYAHAHAHTAVHHWAAQLGLRRLGTRRRHTADEVAALTTPAAEALLGTLFDGPAALRAAARRHQPH
PF05746         --------------------------------l.......leeeeekeLlkalaqfpevleeaaeeleph
PF03485         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ILVRYLESLAAAYHEWWESHSVLPGHEGTADTHTTTVAARLDLCAAAAGVLRAGLLLIGVSAPTRL----
PF05746         rlaeylyeLaaafhsfYnnervlkeeeeel......aaaRLaLvkavrqvLangLdlLGieapekm----
PF03485         ----------------------------------------------------------------------