[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56580.1


[Show Plain Result]

## Summary of Sequence Search
   1::385
 116::287  PF02222 0.0% 47.9289940828402  ATP-grasp domain 
 107::260  PF02786 0.0% 29.6052631578947  Carbamoyl-phosphate synthase L chain, ATP binding d 
 105::274  PF08443 0.0% 25.609756097561  RimK-like ATP-grasp domain 
 133::272  PF07478 0.0% 32.5925925925926  D-ala D-ala ligase C-terminus 
 107::176  PF01071 0.0% 27.536231884058  Phosphoribosylglycinamide synthetase, ATP-grasp (A) 
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSETNRTVPVVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHLGDDRGRDDLLAFAKDS
PF02222         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF08443         ----------------------------------------------------------------------
PF07478         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
PF02222         ---------------------------------------------eelglpvprflaveskeeleeavee
PF02786         ------------------------------------Dkesakealkkinvpvvpssaapvetleealaia
PF08443         ----------------------------------ardKlkslklLakkkikvpktalarseedaekliek
PF07478         --------------------------------------------------------------klekvvek
PF01071         ------------------------------------sKsfakdllkkagiptaeyeaftdpeeakeyiee


                         +         -         -         -         -         *         -:210
query           TGWPVVLKAARGGYDGKGVWVVGDAAEAAAVVERAAREQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
PF02222         lglpvvvKarrlgydGkGqsvvkseeeleqaleal..keeklivEefvpfekElsvlvvRsveGevafyp
PF02786         keigyPviikaafgl.GGkGmrvardeeelaelvkkalaeakaafgnkqvlvekslkgpkeiEvevlrDa
PF08443         ikqfPvvvKsvfgsq.GikvvlaedkqsleqlleafkqlkeailvQefIeeaenrdiRvlVvgdevvaal
PF07478         lgypvfvKpareG.SSvGiskveseeeleeaieeafqydekvlveeai.egreievavlg..neklevse
PF01071         atakalVvKad.glaagKgvivakseeealkavkei----------------------------------


                         -         -         -         +         -         -         -:280
query           VVETVQRGGICHEVIAPAPHLSEDRAVAAQELAIELAAALDVVGLLAVELFETDTGVVVNELAMRPHNSG
PF02222         vvetvqkdgilrlsvapaevsek.qqkkaeeiakkiveeLggvGvlavElFvledgeellvnElapRpHn
PF02786         kgnvitvcerenslql.rtqkvievAPsqtLtdeerqalreaavkvvrev--------------------
PF08443         ervskeGdfrsNlarGgvaeklqlsee....eeelaikaaeameld.vlgvDileskrgllvlE------
PF07478         vgeivlkkgfydyeekyelidssaeievpa.kleeeveekikelakkaykalglkGlaRvDf--------
PF01071         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
PF02222         sGhytld---------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF08443         ----------------------------------------------------------------------
PF07478         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RPGRKIGHVTVVGDDPEALLERARTAAAYLKGDAQ-----------------------------------
PF02222         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF08443         ----------------------------------------------------------------------
PF07478         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------