[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56592.1


[Show Plain Result]

## Summary of Sequence Search
   1::460
   3::311  PF07992 0.0% 39.2857142857143  Pyridine nucleotide-disulphide oxidoreductase 
 342::451  PF02852 0.0% 45.4545454545455  Pyridine nucleotide-disulphide oxidoreductase, dime 
   3::32   PF00070 0.0% 56.6666666666667  Pyridine nucleotide-disulphide oxidoreductase 
 174::252  PF00070 0.0% 35.4430379746835  Pyridine nucleotide-disulphide oxidoreductase 
   3::145  PF01134 0.0% 36.8421052631579  Glucose inhibited division protein A 
 175::207  PF01134 0.0% 42.8571428571429  Glucose inhibited division protein A 
 298::327  PF01134 0.0% 28.5714285714286  Glucose inhibited division protein A 
   3::38   PF01266 0.0% 41.6666666666667  FAD dependent oxidoreductase 
 103::149  PF01266 0.0% 38.2978723404255  FAD dependent oxidoreductase 
 175::205  PF01266 0.0% 29.0322580645161  FAD dependent oxidoreductase 
 212::269  PF01266 0.0% 19.2982456140351  FAD dependent oxidoreductase 
   4::39   PF00890 0.0% 50  FAD binding domain 
 175::204  PF00890 0.0% 30  FAD binding domain 
 279::312  PF00890 0.0% 37.5  FAD binding domain 
   3::32   PF01262 0.0% 46.6666666666667  Alanine dehydrogenase/PNT, C-terminal domain 
 172::209  PF01262 0.0% 28.9473684210526  Alanine dehydrogenase/PNT, C-terminal domain 
   2::33   PF01494 0.0% 37.5  FAD binding domain 
 176::213  PF01494 0.0% 26.3157894736842  FAD binding domain 
 214::253  PF01494 0.0% 22.5  FAD binding domain 
   3::33   PF03486 0.0% 41.9354838709677  HI0933-like protein 
 174::205  PF03486 0.0% 28.125  HI0933-like protein 
 201::283  PF03486 0.0% 18.2926829268293  HI0933-like protein 
   4::115  PF02254 0.0% 23.6363636363636  TrkA-N domain 
 176::211  PF02254 0.0% 22.8571428571429  TrkA-N domain 
   1::460


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
PF07992         --dvviIGgGpaGlaaakrlarlglkvaliere.pggtclnrgcipkkllleaaeee.............
PF02852         ----------------------------------------------------------------------
PF00070         --rvvvvGgGyiGlElAaalaklgkkVtvier--------------------------------------
PF00070         --rvvvvGgGyiGlElAaalaklgkkVtvier--------------------------------------
PF01134         --dviViGgGhAGceAAlaaarlGakvlLithkldtiaels....Cnpsiggi...akgllvrEidalgg
PF01134         --dviViGgGhAGceAAlaaarlGakvlLithkldtiaels....Cnpsiggi...akgllvrEidalgg
PF01134         --dviViGgGhAGceAAlaaarlGakvlLithkldtiaels....Cnpsiggi...akgllvrEidalgg
PF01266         --dvviiGgGivGlstAyeLarrglkVtllekgdiasg--------------------------------
PF01266         --dvviiGgGivGlstAyeLarrglkVtllekgdiasg--------------------------------
PF01266         --dvviiGgGivGlstAyeLarrglkVtllekgdiasg--------------------------------
PF01266         --dvviiGgGivGlstAyeLarrglkVtllekgdiasg--------------------------------
PF00890         ---vvViGsGlAGlaAAleaaeaglkvavvekeqetgga-------------------------------
PF00890         ---vvViGsGlAGlaAAleaaeaglkvavvekeqetgga-------------------------------
PF00890         ---vvViGsGlAGlaAAleaaeaglkvavvekeqetgga-------------------------------
PF01262         --kvvviGaGvvGlgAievakglgaevvaldk--------------------------------------
PF01262         --kvvviGaGvvGlgAievakglgaevvaldk--------------------------------------
PF01494         -tdVlIVGaGpaGlmlallLseaGvrvvlvekh-------------------------------------
PF01494         -tdVlIVGaGpaGlmlallLseaGvrvvlvekh-------------------------------------
PF01494         -tdVlIVGaGpaGlmlallLseaGvrvvlvekh-------------------------------------
PF03486         --dviviGgGaAGlmaAisaakrgakVllldka-------------------------------------
PF03486         --dviviGgGaAGlmaAisaakrgakVllldka-------------------------------------
PF03486         --dviviGgGaAGlmaAisaakrgakVllldka-------------------------------------
PF02254         ---iiiiGlGrvGrslaeeLse.gekdvvvidkdeerveelreeglevvvgdatdeevLeeagiesadav
PF02254         ---iiiiGlGrvGrslaeeLse.gekdvvvidkdeerveelreeglevvvgdatdeevLeeagiesadav


                         -         -         *         -         -         -         -:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
PF07992         ..........eldlkeleerkdegievllntgvtdidkakkkveladgka.............evkydkl
PF02852         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         liikaa.dkagiqfrilNrskGpavralraqvdrelyskev..teklenepnleiieeeveeliveekkv
PF01134         liikaa.dkagiqfrilNrskGpavralraqvdrelyskev..teklenepnleiieeeveeliveekkv
PF01134         liikaa.dkagiqfrilNrskGpavralraqvdrelyskev..teklenepnleiieeeveeliveekkv
PF01266         --------------------------------araaeelGveiiegtkVtglereggrvsgvrtedgsir
PF01266         --------------------------------araaeelGveiiegtkVtglereggrvsgvrtedgsir
PF01266         --------------------------------araaeelGveiiegtkVtglereggrvsgvrtedgsir
PF01266         --------------------------------araaeelGveiiegtkVtglereggrvsgvrtedgsir
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF02254         iaatgdd.eanllavllarelnpkkkiiaraqdeehakllkkaga-------------------------
PF02254         iaatgdd.eanllavllarelnpkkkiiaraqdeehakllkkaga-------------------------


                         +         -         -         -         -         *         -:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
PF07992         viAtGakprtlgipGvelagkgvltsedalrlrekpkkvvvvGgGyigvelaaalakl............
PF02852         ----------------------------------------------------------------------
PF00070         ---------------------------------rvvvvGgGyiGlElAaalaklgkkVtvierrdrllra
PF00070         ---------------------------------rvvvvGgGyiGlElAaalaklgkkVtvierrdrllra
PF01134         kgvvt-----------------------------viViGgGhAGceAAlaaarlGakvlLi.....t---
PF01134         kgvvt-----------------------------viViGgGhAGceAAlaaarlGakvlLi.....t---
PF01134         kgvvt-----------------------------viViGgGhAGceAAlaaarlGakvlLi.....t---
PF01266         adkvvlAaG-------------------------vviiGgGivGlstAyeLarrglkVtllekgd-----
PF01266         adkvvlAaG-------------------------vviiGgGivGlstAyeLarrglkVtllekgd-----
PF01266         adkvvlAaG-------------------------vviiGgGivGlstAyeLarrglkVtllekgd-----
PF01266         adkvvlAaG-------------------------vviiGgGivGlstAyeLarrglkVtllekgd-----
PF00890         ----------------------------------vvViGsGlAGlaAAleaaeaglkvavveke------
PF00890         ----------------------------------vvViGsGlAGlaAAleaaeaglkvavveke------
PF00890         ----------------------------------vvViGsGlAGlaAAleaaeaglkvavveke------
PF01262         -------------------------------pakvvviGaGvvGlgAievakglgaevvaldkrperle-
PF01262         -------------------------------pakvvviGaGvvGlgAievakglgaevvaldkrperle-
PF01494         -----------------------------------lIVGaGpaGlmlallLseaGvrvvlvekhsttvvl
PF01494         -----------------------------------lIVGaGpaGlmlallLseaGvrvvlvekhsttvvl
PF01494         -----------------------------------lIVGaGpaGlmlallLseaGvrvvlvekhsttvvl
PF03486         ---------------------------------dviviGgGaAGlmaAisaakrgakVlleedsgrlFpv
PF03486         ---------------------------------dviviGgGaAGlmaAisaakrgakVlleedsgrlFpv
PF03486         ---------------------------------dviviGgGaAGlmaAisaakrgakVlleedsgrlFpv
PF02254         -----------------------------------iiiGlGrvGrslaeeLse.gekdvvvidkdeerve
PF02254         -----------------------------------iiiGlGrvGrslaeeLse.gekdvvvidkdeerve


                         -         -         -         +         -         -         -:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
PF07992         ................................................................tktlll
PF02852         ----------------------------------------------------------------------
PF00070         ldeeiakilqkklekngievllntkveeiegsadgvevkleg----------------------------
PF00070         ldeeiakilqkklekngievllntkveeiegsadgvevkleg----------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01266         -paklvkalaraaeelGveiiegtkVtglereggrvsgvrtedgs.iradkvvlAaGaw-----------
PF01266         -paklvkalaraaeelGveiiegtkVtglereggrvsgvrtedgs.iradkvvlAaGaw-----------
PF01266         -paklvkalaraaeelGveiiegtkVtglereggrvsgvrtedgs.iradkvvlAaGaw-----------
PF01266         -paklvkalaraaeelGveiiegtkVtglereggrvsgvrtedgs.iradkvvlAaGaw-----------
PF00890         --------------------------------------------------------------------gG
PF00890         --------------------------------------------------------------------gG
PF00890         --------------------------------------------------------------------gG
PF01262         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01494         prAeleriLvehaeerglqvrfktevlsleqdeegvtavvrdk---------------------------
PF01494         prAeleriLvehaeerglqvrfktevlsleqdeegvtavvrdk---------------------------
PF01494         prAeleriLvehaeerglqvrfktevlsleqdeegvtavvrdk---------------------------
PF03486         sdkakdivdallkelkeagvkirletevksvekeedgafrvktkseeeleadklvlAtGGk.SiPklGst
PF03486         sdkakdivdallkelkeagvkirletevksvekeedgafrvktkseeeleadklvlAtGGk.SiPklGst
PF03486         sdkakdivdallkelkeagvkirletevksvekeedgafrvktkseeeleadklvlAtGGk.SiPklGst
PF02254         e---------------------------------------------------------------------
PF02254         e---------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
PF07992         eklglelderGgivvdeylrTsvpgifAaGD---------------------------------------
PF02852         -------------------------------------------------------------vpsvvftdp
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         -----------------kvkgLflAGqinGteGYeEaaa..qGllAG-----------------------
PF01134         -----------------kvkgLflAGqinGteGYeEaaa..qGllAG-----------------------
PF01134         -----------------kvkgLflAGqinGteGYeEaaa..qGllAG-----------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF00890         vrtdenarv..ldadgqpipGLYAaGevaggg--------------------------------------
PF00890         vrtdenarv..ldadgqpipGLYAaGevaggg--------------------------------------
PF00890         vrtdenarv..ldadgqpipGLYAaGevaggg--------------------------------------
PF01262         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF03486         gkg-------------------------------------------------------------------
PF03486         gkg-------------------------------------------------------------------
PF03486         gkg-------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
PF07992         ----------------------------------------------------------------------
PF02852         eiasvGlteeeAkkaggeikvgklpfkandralayaetkgfvKlvvdaetgkvlGahivGpgaseliqel
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGFPE------------------------------
PF07992         ----------------------------------------------------------------------
PF02852         avaikagltvedlantvfihPtlsealkeaa---------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01262         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------