[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56646.1


[Show Plain Result]

## Summary of Sequence Search
   1::169
  48::169  PF00380 0.0% 54.5454545454545  Ribosomal protein S9/S16 
   1::169


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEPTGIEDVQEYDENSEEYPAEYTTETPETVGETYIPTAVGPSLGTGRRKTAVARVRVVPGTGEWKING
PF00380         -----------------------------------------------GrrKtavArvklkegkgkiking


                         -         -         *         -         -         -         -:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHGLARALAAMDPEHNRPPLKKA
PF00380         ksleeylkreilrekvleplevveelkkfdirvkvkGGGlsgqaeAirlaiaraLvaldek.srkeLkkk


                         +         -         -         -         -         *         -:210
query           GFLTRDARKVERKKAGLKKARKAPQYSKR-----------------------------------------
PF00380         glltrDsRrkerkkyglkkARkrsqfskR-----------------------------------------