[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56713.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
 130::240  PF09557 0.0% 46.8468468468468  Domain of unknown function (DUF2382) 
   7::69   PF05239 0.0% 25.3968253968254  PRC-barrel domain 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAPRLGIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGAEVTEQDLRVP
PF09557         ----------------------------------------------------------------------
PF05239         ------asdliGleVytedGeklGkVkDvvidegegdvralvvsvggflgigekevliPfdlavkiggd-


                         -         -         *         -         -         -         -:140
query           FSKKMIKDSPRFETGGHLSPEQEAQLYEHYGVRPKVPGPRGDVEGVAEQERAQQKEETSMTVSEERARIG
PF09557         -----------------------------------------------------------lklseErLevg
PF05239         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTGEEQAAATDRIGEQDQEITLHEERAVVGKEE
PF09557         kervktGevrvrKevveeektveVpverEevvveRrpvtdaeaaaaeeeadleeetievplseervevsk
PF05239         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VPVERVRISKEEVTDTERVKGELRKEHLEVEEEEEEGP--------------------------------
PF09557         eavvtEeVsvgkeeveetetveetvrreel----------------------------------------
PF05239         ----------------------------------------------------------------------