[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ56815.1


[Show Plain Result]

## Summary of Sequence Search
   1::390
  41::167  PF00004 0.0% 23.7623762376238  ATPase family associated with various cellular acti 
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVFDTLVGQDTVVQRLRAAVRAADNLLSGGDGTGMTHAWLFTGPPGAGRAQAARAFAAALQCTHGGCGE
PF00004         ----------------------------------------llyGppGtGKTllakavakelgve......


                         -         -         *         -         -         -         -:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
PF00004         ................fleisgsellskyvgesekkirelfkeakeka...p.svlfiDEidalaksrgs


                         +         -         -         -         -         *         -:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIIDALVTRDGIDRDRAVAAARAAAGHLERARQ
PF00004         eseeeervvnqLlteldglkkkeskvl-------------------------------------------


                         -         -         -         +         -         -         -:280
query           LATDETARARREEVLTIPARLDSLGACVHAAARLYEIAEADAKESTAALDEQEKADLKAAFGEGATGKGV
PF00004         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AKAVRGAAGALKELEERQKRRATRIKRDAYDTFLMDLVAFYRDVLAIQLGASVELSTADRDADLRRVARS
PF00004         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           STPEATLRRIDAIMECRRRINANVHPQIAMEAMTAALYLG------------------------------
PF00004         ----------------------------------------------------------------------