[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ57003.1


[Show Plain Result]

## Summary of Sequence Search
   1::792
  13::389  PF09364 0.0% 60.6382978723404  XFP N-terminal domain 
 589::791  PF09363 0.0% 64.0394088669951  XFP C-terminal domain 
 402::578  PF03894 0.0% 66.6666666666667  D-xylulose 5-phosphate/D-fructose 6-phosphate phosp 
   1::792


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSTESVPRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
PF09364         ------------seeelkkldkywraanylavgliylkdnpllreplkeedvkarllGhWGtvpGlsfly
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
PF09364         ahlnriikkydqnmlyvvGPGhGgpalvaasyldgsyselypeiskdeeGlkklfkqfsfPGGipshvaa
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLVVAAVVGDGEAETGALSGSWQSIRFLNPARDGAVLPILHLN
PF09364         etPGsiheGGelGyalshayGavldnPdlivacvvGdGeaetGPlatsWhsnkflnPaedGavlPileln
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
PF09364         GykisnptilarisdeelkklfeGlGyepafvededteslhkllaevldkaveeihdiqkear.sneeas
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
PF09364         rPkwPmiilrtPkGwtgPkyvdGkkvegsfrahqvPlalarentaklelleeWlksykpeelfdedgslk
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PETTTVVPPPDCRISSSPHANGGLLLRDLLLPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF
PF09364         eelkelaPkgekrlaanpeanggllrrelklPdlkeyav-------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         ---------------------------------------------------trvlgkylrdvlklndknf


                         -         -         +         -         -         -         -:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         rifgPdetasnrleavfevtkrqwleeikeeddeelsakegrvvevlsehlceGflegylltGrhgifas


                         *         -         -         -         -         +         -:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         yeaflrvvdsmlnqhakwlkaarelkWrkdiaslnllvsstvwrqdhnGfshqdPglldvllnkkadvvr


                         -         -         -         *         -         -         -:630
query           LPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------KqpelqylsleeAekhcekGlgiwdwasndkgeepdvvlasa
PF03894         vylpadantllavvdkcl----------------------------------------------------


                         -         +         -         -         -         -         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVDLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWL
PF09364         ----------------------------------------------------------------------
PF09363         GdvptlEtlaavellreelPelkirvvnvvdllkLqkeeehphglsdeeFdelFtkdkpvifafHgypkl
PF03894         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           IHRLTYRRAGHPNLHVRGYKEEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDERLR
PF09364         ----------------------------------------------------------------------
PF09363         ihrllykrknhenlhvrgYkeeGtitTpfdmavlneldRfhlaidaiervpkleekaaelkeklkdklee
PF03894         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           CRAYTRQYGEDAPDIRNWVWEP------------------------------------------------
PF09364         ----------------------------------------------------------------------
PF09363         hkeyireegeDlpeiedwkwk-------------------------------------------------
PF03894         ----------------------------------------------------------------------