[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54134.1


[Show Plain Result]

## Summary of Sequence Search
   1::267
   1::267    4e-75 48.0% 0043521 00435211 1/1   nopimelate epimerase-like               
   1::129  1.9e-43 51.6% 0051110 00511101 1/1   nopimelate epimerase-like               
 112::267  8.7e-39 50.7% 0049368 00493681 1/1   nopimelate epimerase-like               
   1::125  7.3e-38 47.6% 0044177 00441771 1/1   nopimelate epimerase-like               
   1::126  5.5e-37 48.4% 0043560 00435601 1/1   nopimelate epimerase-like               
 113::268    1e-34 45.3% 0049758 00497581 1/1   nopimelate epimerase-like               
 125::267    1e-34 46.8% 0051111 00511111 1/1   nopimelate epimerase-like               
   8::126  1.2e-19 26.1% 0046028 00460281 1/1   nopimelate epimerase-like               
   1::267  2.1e-17 23.6% 0044048 00440481 1/1   nopimelate epimerase-like               
   1::267


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
00435211   1/1  melpfllvdaFtdepflGNpaaVvlladglsdelmqaiArelnlsetafvlppd...adfrlriFtPdge
00511101   1/1  kldfllvdaFtdepfgGNpaaVvlladglsdelmqaiAaelnlseTaFvlpp.sdgadyrlriFtPtgEv
00493681   1/1  ----------------------------------------------------------------------
00441771   1/1  alkfylvdaFtdepfgGnpaaVvlladglsdalmqaiarelnlsetaFvlppsdp.adyrvriftpagel
00435601   1/1  lpllalklelmmlldvlvvdvFtdvhflGNPaaVvlladllsdelmqaiarelnlsetafvlpp..ddad
00497581   1/1  ----------------------------------------------------------------------
00511111   1/1  ----------------------------------------------------------------------
00460281   1/1  -------lkFtkmhglGNdfvvvdlrdllldltaeliaalcdrrfgigadglllvlpsldegadfrmrif
00440481   1/1  mrssvrlrvvdvht....gGnplrvvldgvpalpgglllekrqaiarldnlretlllePrGhgvmvgall


                         -         -         *         -         -         -         -:140
query           DLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
00435211   1/1  vpfcGHatlaaaavllelgglpggtlvletkaGlltvrvegglialdfplprllplllpaeladalgl..
00511101   1/1  plaGhatlaaaavllelgllgvlvletlaglltveldgglilldlpapllepllipell-----------
00493681   1/1  -----------------------------------------eldlpallaaalgldlddl..lsglppvv
00441771   1/1  pfcGhatlgaahallelgglvpdttlvleletgsgpvevrregdglvldfplprp---------------
00435601   1/1  frlriftpggevpfCGhgtlaaaaallelgllsggtltletpaGlltvellledgl--------------
00497581   1/1  ------------------------------------------gdfpslellaaalglalldllg.lppvv
00511111   1/1  ------------------------------------------------------lleelaaalglslddl
00460281   1/1  naDgseaemCGNGtrcvarfllekglvgkdeitvetlaglllvtvlgdglvsvdmg--------------
00440481   1/1  lpptdpdadagvlffnpdgelpmcGhgtigvatallelGlvpkeepvgrlvletpaGlvevevevdggkv


                         +         -         -         -         -         *         -:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
00435211   1/1  pvlvstglphlvvvldsleavlalrpdleallelplrvgvvvvaly...sdadfvsRvfapglgvaeDpa
00511101   1/1  ----------------------------------------------------------------------
00493681   1/1  vstglrfllvvlesleallalrpdlealaelleelgvlgvivtalgdeg..adfvsRmFaPalgilEDPv
00441771   1/1  ----------------------------------------------------------------------
00435601   1/1  ----------------------------------------------------------------------
00497581   1/1  vstgldfllvll.sleallalrpdlealklldglgvivtal...fdlddfvsRvF.palgilEDpaTGsa
00511111   1/1  ppvvvstglpfllvplksleallalrpdlaalaellllvvivta....gddadfvsRmFapalgipEDPa
00460281   1/1  ----------------------------------------------------------------------
00440481   1/1  esvtflnvpaflaaldvsvevpglgtvtvdi..vygGnpyavvdvadlglslelsnaaellalgpairaa


                         -         -         -         +         -         -         -:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRY-------------
00435211   1/1  TGsaaaalaaylaarllklllvqgqasgrgglllvevd...dgrvlvgGravlvleg-------------
00511101   1/1  ----------------------------------------------------------------------
00493681   1/1  TGsahaaLapyllwagllgkdegllrlvaeQGvasgrgglllvellgdggkilrvlv-------------
00441771   1/1  ----------------------------------------------------------------------
00435601   1/1  ----------------------------------------------------------------------
00497581   1/1  aaalapylaelglllgklelvaeQGvasgrgGlllvellgdg..rvlvgGravtvleg------------
00511111   1/1  TGsaaaaLaaylaelllldgklslvieQGvamgrpglllvevdgdggeilrvlvgGr-------------
00460281   1/1  ----------------------------------------------------------------------
00440481   1/1  lleqllvvhpedpllhnvyfvilvglldddedad.ernvvvfedgaidrsPcGtgts-------------