[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54138.1


[Show Plain Result]

## Summary of Sequence Search
   1::777
 631::727  1.1e-26 39.2% 0050575 00505751 1/1   ic acid-binding proteins                
 638::722  7.8e-23 43.5% 0048887 00488871 1/1   ic acid-binding proteins                
 649::721  1.6e-22 54.2% 0047019 00470191 1/1   ic acid-binding proteins                
 641::722  1.4e-20 43.9% 0051771 00517711 1/1   ic acid-binding proteins                
 647::721  2.2e-20 47.3% 0049455 00494551 1/1   ic acid-binding proteins                
 639::722  7.2e-20 45.2% 0047828 00478281 1/1   ic acid-binding proteins                
 648::725  1.2e-18 48.6% 0052107 00521071 1/1   ic acid-binding proteins                
 644::727  1.3e-17 43.9% 0040675 00406751 1/1   ic acid-binding proteins                
 652::727  2.9e-17 39.5% 0049427 00494271 1/1   ic acid-binding proteins                
 649::725  1.9e-16 46.1% 0051177 00511771 1/1   ic acid-binding proteins                
 644::721    3e-16 43.7% 0038590 00385901 1/1   ic acid-binding proteins                
 657::714  1.1e-15 53.4% 0046451 00464511 1/1   ic acid-binding proteins                
 648::720  2.2e-10 40.3% 0047715 00477151 1/1   ic acid-binding proteins                
   1::777


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIEERLRYLRELEERRT
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLEPEEPAEDPRARSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMVSEAG
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ASVYSASAYASQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNVAAFGAFVDVGVHHDGLVHVSAMSKSFVKDPRDVVKPGD
00505751   1/1  islslkelledsllsledlkvGdvvtGtVvsvtdfgvfVdlglggveGlvpiselsddlrvedpeevlkv
00488871   1/1  -------lldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpiselsdkrvedpedvlkv
00470191   1/1  ------------------lkvGevveGtVvsvtdfgafVdlg.gveGlvhiselsddrvlfdeerlalvg
00517711   1/1  ----------pwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpiselsddrvedlsdvlkv
00494551   1/1  ----------------edlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedleevlkvgd
00478281   1/1  --------ldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpiselsddrvedlsdvlkv
00521071   1/1  -----------------kpfkgevveGvVtsvtkfgvfVdlggv.egfvpiselsddrvydfdekllllv
00406751   1/1  -------------ellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllkrvedpsell.
00494271   1/1  ---------------------GdivkGkVvkilpglegafVdiglgvegflpiselslellllelslkrv
00511771   1/1  ------------------PfkgevveGtVvsvtkfgvfvdlggv.egfvplselsddrvfdedenllvwe
00385901   1/1  -------------yeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels......pgevlkvgd
00464511   1/1  --------------------------GtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvl
00477151   1/1  -----------------kdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli......pg


                         -         -         -         -         +         -         -:770
query           IVRVKVLDVDVRRKRISLTLRLDDEVDQRSGENNRSGGERRERGAPRRGDQRRQRGGRGEQQPMGAMAEA
00505751   1/1  GdevkvkvlsvdpekgrisLSlkkall-------------------------------------------
00488871   1/1  gdevevkvlevdkekgrivLSl------------------------------------------------
00470191   1/1  edpsevlkvGdevevkvlevd-------------------------------------------------
00517711   1/1  gdevevkvlsvdkekgrivLSl------------------------------------------------
00494551   1/1  evkvkvlkvd.ekgrivLslk-------------------------------------------------
00478281   1/1  gdevevkvlevdkekgrivLSl------------------------------------------------
00521071   1/1  gedlelvlkvgdevrvkvlevdkee---------------------------------------------
00406751   1/1  vGdevkvkvlevdkekgrivLslkkll-------------------------------------------
00494271   1/1  edisdvlkvGqevlvkvlkvdlgnkgi-------------------------------------------
00511771   1/1  dlelvlkvgdevrvkvlgvdlekgr---------------------------------------------
00385901   1/1  rvkvkvlevdkerkgivlslk-------------------------------------------------
00464511   1/1  kvgdevevkvlevd--------------------------------------------------------
00477151   1/1  evlkvgdrvkvyvlevdkes--------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LRRAGLV---------------------------------------------------------------
00505751   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------