[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54145.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
  48::299  2.5e-24 26.5% 0051159 00511591 1/1   lo-dependent phosphatases               
  46::305  2.1e-23 29.8% 0053347 00533471 1/1   lo-dependent phosphatases               
  55::258  7.8e-18 36.0% 0051479 00514791 1/1   lo-dependent phosphatases               
  55::302  6.4e-17 30.3% 0039040 00390401 1/1   lo-dependent phosphatases               
  55::258  8.9e-16 33.6% 0043485 00434851 1/1   lo-dependent phosphatases               
  54::279  1.3e-15 28.0% 0049468 00494681 1/1   lo-dependent phosphatases               
  51::258  6.2e-14 25.4% 0049558 00495581 1/1   lo-dependent phosphatases               
  58::258  1.2e-13 29.2% 0051021 00510211 1/1   lo-dependent phosphatases               
  55::280  4.9e-13 27.9% 0049880 00498801 1/1   lo-dependent phosphatases               
  55::266    1e-11 29.3% 0051688 00516881 1/1   lo-dependent phosphatases               
  51::258  3.4e-06 23.9% 0044518 00445181 1/1   lo-dependent phosphatases               
  55::92   0.00039 31.6% 0048962 00489621 1/1   lo-dependent phosphatases               
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNTTGRVLRRIGTAAAVTGALGVAGLVYASVVERNWFRLRHYEIPILAPGSDRLRILHLSDAHLTPGRR
00511591   1/1  -----------------------------------------------lpsaddpmrilhisDlHggdgll
00533471   1/1  ---------------------------------------------p..pgldgpmrilhisDlHlg..la
00514791   1/1  ------------------------------------------------------mrilvisDlHlggnla
00390401   1/1  ------------------------------------------------------mkilhisDlHlgsply
00434851   1/1  ------------------------------------------------------mkilvisDlHg..gld
00494681   1/1  -----------------------------------------------------pmrilvisDlHgg..ld
00495581   1/1  --------------------------------------------------mpdtlrilhtgDihggggla
00510211   1/1  ---------------------------------------------------------nkiMlvisDlHlg
00498801   1/1  ------------------------------------------------------lllmmmrilhisDlHl
00516881   1/1  ------------------------------------------------------mlmmkilviSDlHg..
00445181   1/1  --------------------------------------------------pdgpfrflvisDlhlglpgp
00489621   1/1  ------------------------------------------------------gpfrflvigDlhlgpp


                         -         -         *         -         -         -         -:140
query           LLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSS
00511591   1/1  allealleli.ekpDlvlilGDlvydrgvgddsleeldellellrklaagipvyvvpGNHDfdlg.....
00533471   1/1  alerllelaireekpDlvlflGDlvdggppsedyrklydevlellralk..agvpvyvvlGNHDfdngls
00514791   1/1  allellkellaelkpdlvlflGDlvdrg.....vlellkel.gipvylvlGNHDf...............
00390401   1/1  glpsrledtlealerlldlakeekpDlvliaGDlfdggvpspeayellaellkrlaeagipvyvipGNHD
00434851   1/1  alealldllreekvdlvihlGDlvdggp.....lellrel.gipvvavlGNhDfllllevlledil....
00494681   1/1  alerllellgalkpdlvlflGDlvdrgppslevlgllfllllellkkl.gipvylvlGNH..........
00495581   1/1  rlatllkelraelgpdlllvnlGDlfqgsplseavadalnal.gvdvvtl.GNHe.fdygl.glletlea
00510211   1/1  leepglsrgvdsplaalerllellnallekpdlllllGDlvdrgpeslevlellral.gipvylvlGNHD
00498801   1/1  gld..aleallelandlgpDavvlaGDltdrgsvpaeyaallellsel.gvpvlavpGNhDaplle....
00516881   1/1  nlralelleallellkalkvdlvihlGDlvdgg.....vlellkal.gipviavrGNhDfl.........
00445181   1/1  rggedtldtlealveainal...kpdfvlllGDlfygggpldltdeafeeefervleplasl.gipvyvv
00489621   1/1  gerlleadilvaealaalaeae------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTAD
00511591   1/1  .............eyllkaaglealleplnlpengpgtlgglyysleiggvriigldtrtygrlgdeqle
00533471   1/1  l........................eglrdflaelgfpvlpanvldgfgglyyvfeiggvrivvlggltp
00514791   1/1  ......................................................qlewleelllaae...
00390401   1/1  ..........................yplglealldlleelgvivllgepvlvlegdglriigldsappl
00434851   1/1  ........................elldllpealvlelgglr............................
00494681   1/1  ......................................................dlllgdlleelldllp
00495581   1/1  ..nfpvlsanvfgagtglplak..pyvilevggvkiavigltgpsllkgltftdp.vealkkll..akeg
00510211   1/1  fylglslll.............................................................
00498801   1/1  ..lllrllnplvlyrry..................illllepvvelgglrivglggslptppltlrellg
00516881   1/1  ...............lglellellallpeylvleigg.................................
00445181   1/1  pGNHD.........................yygglsaalafaaylsrfglpgvdgplyysfdvggekvrf
00489621   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGG
00511591   1/1  wleeelaelrrsgapwiivlsHhppyssgdkdswiglvgrealldllkkygvdlvlsGHtHrpqivelid
00533471   1/1  rdddldqlewlerelaelrasgadwvivlsHhppygsgldgsdgylagrealldllekygvdlvlsGHtH
00514791   1/1  glrillvHgplggllggaeallelleeygvdlvlsGHtHvpqivel.g----------------------
00390401   1/1  lrdgetrvalyglgylgdeqldwlaellkeakdpdkpvilllHhplvgvllagsdryaligldalle.gv
00434851   1/1  ..illtHgpplpdllllarelgvdlvlfGHtHrpq.vvevggtlvvnp----------------------
00494681   1/1  llalilgglrillvHgplspdldllerygvdlvlsGHtHvpqgve.lggvlvinpgsvggyrlge.pps-
00495581   1/1  adliivlsHagveseqralarlldggvdlvlgGHtHvlqpdieiyngg----------------------
00510211   1/1  .lewleellaaleldg.lvilltHgplypsldlllqlgaealldllkr----------------------
00498801   1/1  rlsaeqlewllkalaeapdrptvlllHhppagtggahvgsdallellaeagvdlvllGHiHrpr..vvig
00516881   1/1  ......lkillvHghlldvlvdpeallalareldadvvisGHtHrpl.ieelggvl--------------
00445181   1/1  ivldsndlsgpsppllddrgpgdvsgalgeeqlawLeaeLaaaka...----------------------
00489621   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LGTSPYAPVRFCCRPEAALLDLIPRA--------------------------------------------
00511591   1/1  gityvnsgsggsgsyge..---------------------------------------------------
00533471   1/1  vpqrilvldggtlvvnpgsys....---------------------------------------------
00514791   1/1  ----------------------------------------------------------------------
00390401   1/1  dlvllGHiHrpqiv.plggtlv------------------------------------------------
00434851   1/1  ----------------------------------------------------------------------
00494681   1/1  ----------------------------------------------------------------------
00495581   1/1  ----------------------------------------------------------------------
00510211   1/1  ----------------------------------------------------------------------
00498801   1/1  ----------------------------------------------------------------------
00516881   1/1  ----------------------------------------------------------------------
00445181   1/1  ----------------------------------------------------------------------
00489621   1/1  ----------------------------------------------------------------------