[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54436.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
  32::307  3.9e-73 40.1% 0051135 00511351 1/1   lo-dependent hydrolases                 
  28::305  1.1e-71 41.7% 0039386 00393861 1/1   lo-dependent hydrolases                 
  28::306  9.1e-70 40.0% 0051670 00516701 1/1   lo-dependent hydrolases                 
  30::306  8.1e-68 40.6% 0051322 00513221 1/1   lo-dependent hydrolases                 
  30::305  3.5e-49 31.0% 0037271 00372711 1/1   lo-dependent hydrolases                 
  34::306  2.2e-44 30.7% 0053093 00530931 1/1   lo-dependent hydrolases                 
  26::304  5.7e-43 32.2% 0045950 00459501 1/1   lo-dependent hydrolases                 
  34::305  7.5e-37 30.0% 0052789 00527891 1/1   lo-dependent hydrolases                 
  30::306  1.2e-34 28.9% 0052371 00523711 1/1   lo-dependent hydrolases                 
  32::305  2.6e-30 27.6% 0047006 00470061 1/1   lo-dependent hydrolases                 
  34::305  4.1e-30 24.1% 0052760 00527601 1/1   lo-dependent hydrolases                 
  32::306  1.1e-28 28.8% 0053002 00530021 1/1   lo-dependent hydrolases                 
  34::308    7e-24 24.0% 0051086 00510861 1/1   lo-dependent hydrolases                 
  34::305  9.6e-18 23.7% 0047785 00477851 1/1   lo-dependent hydrolases                 
  29::306  2.6e-17 21.7% 0052488 00524881 1/1   lo-dependent hydrolases                 
  31::308  3.3e-17 19.6% 0051353 00513531 1/1   lo-dependent hydrolases                 
  34::308  6.5e-16 19.1% 0047519 00475191 1/1   lo-dependent hydrolases                 
  31::305    1e-06 19.5% 0052605 00526051 1/1   lo-dependent hydrolases                 
  32::307  0.00045 18.1% 0038137 00381371 1/1   lo-dependent hydrolases                 
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSVSKSRRQREKRDRARTEPPPLPEPLRVAVPDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
00511351   1/1  -------------------------------liDthcHldllvfdddldevleraaeagvekllvvgtdl
00393861   1/1  ---------------------------llmmliDsHcHldllvfdgdldevlerareagvtrlvvvgtdl
00516701   1/1  ---------------------------llpgliDaHvHlddpgfdedleevlarakaagvttivvvgtdl
00513221   1/1  -----------------------------mmliDsHcHlddllfegfaedleevlerakaagvtkivvvg
00372711   1/1  -----------------------------glvrtvlGpidpeelglvdsHeHLdldlsgllndlplalel
00530931   1/1  ---------------------------------GlIDtHvHli..epfletleevleaalaaGVttvvda
00459501   1/1  -------------------------dpeelgftdsHeHllldlsgrlldpdlglddleaaleeleaakea
00527891   1/1  ---------------------------------GlIDtHvHldepglgdgefledlesgtaaaaagGvtt
00523711   1/1  -----------------------------ldgkvrTvlGpidpdelglvdtHeHLlvdlfgvyldpllll
00470061   1/1  -------------------------------GliDtHvHlrepglthkledlesgtraaaagGvttvvdm
00527601   1/1  ---------------------------------PGliDsHvHlrepflglelkedlesgtraaaagGvtt
00530021   1/1  -------------------------------mpiIDaHvHlfppdlleylwllgalapdallhvfglpdr
00510861   1/1  ---------------------------------GliDlHvHlrepglehkedlesgtraaaagGvttvid
00477851   1/1  ---------------------------------PGlIDtHvHlrepllglefkedlesgtraaaagGvtt
00524881   1/1  ----------------------------dmmiIDahtHlfppalpdylpakfrdrapfrpvlpgdwdlee
00513531   1/1  ------------------------------GliDlhvhlrepfgglehkedfesgtraAaagGvttvvdm
00475191   1/1  ---------------------------------GlidtHtHldqtllrglaldlsllewlely.tfplea
00526051   1/1  ------------------------------miIDaHvHllppalldllaalgpggprgplppladlearl
00381371   1/1  -------------------------------iiDvHvHlrdpgllaetvetlarlleaalaaGfgravvm


                         -         -         *         -         -         -         -:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATEWEPARPAGGEAALEEALAEIDALAAHEKVCA
00511351   1/1  edsrralelaerypgvyaalGlhPlyadelleev.......................lelleellkkpkv
00393861   1/1  edfdralelaerypnvyaavGvhPleaeellee.......................aleeleelledpkv
00516701   1/1  edfekllelaekypnvyaalGvhplevdelaeev.......................ldeleelleelrp
00513221   1/1  tdledsekllelaekypnvyaavGihPleakelee.........................ldeleellee
00372711   1/1  lldllerareeleralaaGvrtivdvtttglgrdlllllelaeetgvnivaatGlypdafl.........
00530931   1/1  ggtglenfeamlelaekyplrvlaflnisvvglhpl.........................dflgdgdel
00459501   1/1  GvrtivdvttyglgrdlaallelaeetgvnivattGlyp...........lealpdavaalsveelaell
00527891   1/1  vvvmpntvpgtdtldglleslelrllalaee.kvyvdvglhpgltplrllvmgdr...............
00523711   1/1  dteldlvelaleeleellaaGvttivdvttlglgrdllllleiaeetginivaatGly............
00470061   1/1  pntlppidtlealaaklerakaavgvdpgfhgglt.......................genleelaelae
00527601   1/1  vvdmpntlppidtleallalleraeealyvdvgfhpgltgl........................ngeel
00530021   1/1  ltlldgldwrlylpgdadlderladmdaaGvdaavlvptlpgpvygtdleealalaralndwlaelaaay
00510861   1/1  mpntippvtglealeaylelaeekslvdylftggltpglaleel..........................
00477851   1/1  vvdmpntvppittlealeayleraeeaap..vnvgplggltll..................egenleela
00524881   1/1  rlalmdaagvdaavlsptspggsdildpelalalaralNdwlaelaaaypdrfigvavvpl.........
00513531   1/1  pntlpvtdtlealeaklelaeg..kayvdygfhg........................altglngeelae
00475191   1/1  lltpedlyaaallallellrsGvttvedfgtlhdalaeaaeelgiravlglvlmdrpppd..........
00526051   1/1  almdeagvdravlsptapgfyeldpelaaalaralNdwlaelvaaypdrfvglatlplldp.........
00381371   1/1  Pnleppvtnleaalayraral......................gaapcdvgplmtltlddettleelrea


                         +         -         -         -         -         *         -:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
00511351   1/1  vaiGEiGLDyyr.dlsdlelQlevFeaqlelAkelglPvilHtrdahddlleilkelllpllggvlHcFt
00393861   1/1  vaiGeiGldyyr.dledkelqlevFeaqlelakelglPviiHtrdahddlleilkelglpplkgvlhcfs
00516701   1/1  kvvaiGeiGldyylsksp.lelqlevfraqlelakelglpviiHtrdapedlleilkelgldlrvvlHcf
00513221   1/1  pkvvaiGEiGldyyl.dlsdkelqlevfeaqlelakelglpviiHtrdahddlleilkeyglpllkvvlH
00372711   1/1  ......svallsveelaellvaeieegidgtdikagaiGeigldyit......eleekvlraaaraaret
00530931   1/1  tleelaelikvvaigeiGLklfmdysavieaqkevleaalelakelkdlpvvvHvrdapedlleil.ell
00459501   1/1  ikeilegidgtgikagvigigetgldyit......pleekvfraaaraaaetglPvivHtplrdaglell
00527891   1/1  ..getleelrelaea.....iGaiGlklylty.sglgvqdeelrrllelaaelglpvivHaedadliddl
00523711   1/1  ...pdafldvlalsveelaelvvkeieegadgtgvkaGviGeigldgit......pleekvlraaaeaar
00470061   1/1  ag.vvgikefgld.stnddlgv.lqlevlrralelakelglplivHaededlidelleglkneg.ilggv
00527601   1/1  eelrellk.....aaGaiglklyltysdlgvaddeelrellelaaelglpvivHaededliddlleille
00530021   1/1  pdrfagvgvvpl..........................hdpeaalaeLerlval......Gvrgvklypa
00510861   1/1  ..........aelvalgvaglklfmdg.gllvvddevlrralelakelglpvlvHaed..pdliegllee
00477851   1/1  elake.....aGaiglklymtdsglgvvddellrealelaaelglpvlvhaed..edliellleglaneg
00524881   1/1  .................adpeaavaeleraveelgfrgvrlnplpvggldlslrylddprfdplwealae
00513531   1/1  laelvaeagvvafkefm.....sydgllvvddevlrralelakelglpvlvHae..dgdlidilleglln
00475191   1/1  ..alsleealelleealgagglvvvglaphspytvsp.......ellravlelarelglpvhiHlaetld
00526051   1/1  .................daavaeleraveelgfrGv......klnpqvgglylddprldpllealeelgl
00381371   1/1  vkaGvvGlklyptysslgvvddeklypvleaaqelglplliHaevtdlivdifdrilelgvtavelhlls


                         -         -         -         +         -         -         -:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDAAAVVPLELLLVETDAPFLTPKPHRGRPNAPYLIPHTLRAL
00511351   1/1  gslelakalldlgfyisisgvvtfklnaeelrevvklipldrlllETDaPylapvplrglllgkrnePay
00393861   1/1  gsleeakelldlgfyisisgivtfknakelrelvkllpldrlllETDaPylapvpyrgkrnePayvplva
00516701   1/1  tgsleealalldlgvyisisgvvtfkraeelrellkaipldrllleTDaPylaplpyrgkrnepaylplv
00513221   1/1  cftgslelakelldlgfyisisgiitfkrakelrellkaipldrllleTDaPylapvplrgkrnepaylp
00372711   1/1  glPvivHtregddaglevlellleegvdpskvvigHlfrsldleyalellelGayisfdgigldlllpel
00530931   1/1  eegdiviHcfhgsaagilvaeeatllelalealelGvyidigggstfknakalrealk.igldrllleTD
00459501   1/1  dilkeegvdpskvvigHcdftgdleyllelldlGayisfdgigtfkyppdeeraellkelvregpldril
00527891   1/1  leilkeeg.ilggvlhlfsgpaeaEavaaaraldlarypglplhithlstkealeliraapleglnvtae
00523711   1/1  etglpvivHtsegteaglevleilaeegvdpsrviigHldrtldpeyllaladlGvylgfdgigtfkynl
00470061   1/1  lhlfsrpaeaeaeaidralylaeftglrlhivhvttkeavelieaakalgld.vtaetdphhLllteedv
00527601   1/1  eglt.ggvlhlfsrpaeaelealalglllasftglplhivhvstkealelieaakalgl.rvtaettphh
00530021   1/1  g.sgpglddpafrpvleaaaelglpvdlHvgegalddvlelsdapvlfshpletalaalrlvldgvlarf
00510861   1/1  gvtslrlhlhsrpaeaeaaaiaralllarltglrlhivhvstaealelira.akakgln.vtaettphhL
00477851   1/1  ifdsvlhlfsrpaeaeaeaidralelaretglplhithistaealelireakaegllvtaevtphhlllt
00524881   1/1  lglpvflHpgapglpallalgagpllldplvgfplettrallslilsgvldrfPdlkivlaHgGgwlpyl
00513531   1/1  egitgprlhllsrpaeaeaeavaralllaeltgaplhivhvstaealelireakarglnvtaevtphhLl
00475191   1/1  evrpvelleelgllgprtllaHcvhlsdeeiellaetgvvvvhcPtsnlklgs......giapvrellda
00526051   1/1  pvllHpgtppgldalvdpallpalvgfplettlallslilsgvldrfPnlkivlaHlGgalpyllgrldk
00381371   1/1  rPeeaealfiarvlellelpnlrivlehittkdavelvaeakgkGlnvaatvtahhLllnrnalleggri


                         -         *         -         -         -         -         +:350
query           AELKGMAEDELAETVAANARRAFALP--------------------------------------------
00511351   1/1  vplvaevlaelrgisleelaeitteNa-------------------------------------------
00393861   1/1  eaiaelrglsleevaeitteNalrl---------------------------------------------
00516701   1/1  aealaelrglsleevakilteNaarl--------------------------------------------
00513221   1/1  evaeklaelkglsleelakitteNaa--------------------------------------------
00372711   1/1  nislqgrvdyypdfkraellrelvd---------------------------------------------
00530931   1/1  apyltp......rnepvysllvalsl--------------------------------------------
00459501   1/1  lstDagrllplplrggpgypyilk----------------------------------------------
00527891   1/1  tdphhLlltpedlavaesllrdlvl---------------------------------------------
00523711   1/1  llnlsalgdvdllsdeeraallrelv--------------------------------------------
00470061   1/1  aglgtlfkclPplrseedreaLwea---------------------------------------------
00527601   1/1  lllteedllelgialgtlakllPpl---------------------------------------------
00530021   1/1  pknlkivldHlggarplllerldall--------------------------------------------
00510861   1/1  lltdedlgglgtlakcnPplrseedrea------------------------------------------
00477851   1/1  redlldgglllgtlakclPplrlse---------------------------------------------
00524881   1/1  lgrldlalralralarldlkrdpsey--------------------------------------------
00513531   1/1  ldeedledlglegalykvnPPlRskedr------------------------------------------
00475191   1/1  GvnvglgtDgpasnpsldmleemrlaal------------------------------------------
00526051   1/1  lpevre.......aldlleyl..pn---------------------------------------------
00381371   1/1  rphyyclPiLkreadreaLiealtsGn-------------------------------------------