[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54441.1


[Show Plain Result]

## Summary of Sequence Search
   1::1523
 689::890    1e-12 25.0% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
1211::1421 9.5e-10 27.3% 0052100 00521002 2/2   ike                                     
1188::1428 2.3e-09 19.7% 0042932 00429321 1/1   ike                                     
1325::1486 2.9e-08 27.1% 0052646 00526462 2/2   ike                                     
1294::1429 4.1e-08 27.3% 0052670 00526703 3/3   ike                                     
1218::1407 6.9e-08 29.9% 0051642 00516422 2/2   ike                                     
 705::927  1.2e-07 20.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 706::919  4.1e-07 21.5% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
1298::1411 6.2e-07 24.5% 0040251 00402512 2/2   ike                                     
1283::1410 1.4e-06 27.7% 0047256 00472562 2/2   ike                                     
1096::1421   2e-05 25.3% 0050358 00503581 1/1   ike                                     
1120::1319 3.3e-05 29.7% 0052646 00526461 1/2   ike                                     
1118::1281 6.5e-05 25.8% 0040251 00402511 1/2   ike                                     
 706::818    7e-05 19.8% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
 706::844  8.6e-05 23.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
1202::1419   9e-05 20.0% 0048699 00486991 1/1   ike                                     
1299::1411 9.8e-05 28.9% 0045692 00456922 2/2   ike                                     
1301::1410 0.00025 29.2% 0039276 00392762 2/2   ike                                     
1252::1411 0.00051 24.8% 0046495 00464951 1/1   ike                                     
 706::906  0.00059 21.6% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
1293::1414 0.00077 26.7% 0051240 00512403 3/3   ike                                     
 730::891  0.00097 23.3% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
1180::1285  0.0015 21.4% 0052670 00526702 2/3   ike                                     
1345::1448  0.0032 26.1% 0047366 00473662 2/2   ike                                     
1174::1278   0.016 27.4% 0051240 00512402 2/3   ike                                     
1119::1280   0.092 26.9% 0047366 00473661 1/2   ike                                     
1120::1242   0.097 30.1% 0047256 00472561 1/2   ike                                     
 962::1177    0.19 19.6% 0052670 00526701 1/3   ike                                     
1170::1280    0.32 25.5% 0045692 00456921 1/2   ike                                     
1210::1281     5.8 28.1% 0039276 00392761 1/2   ike                                     
1120::1159      13 32.5% 0052100 00521001 1/2   ike                                     
1120::1155      18 30.6% 0051642 00516421 1/2   ike                                     
1120::1159      39 35.0% 0051240 00512401 1/3   ike                                     
   1::1523


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSRRSHETPQGPDPRSPGAAPAYREAPPALTGRELADAVYLAAWQQHTAQHPPARPSGGKDTALYAPSR
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VRGALLARPSQQRHDPKRRRHRVRGALLARPSGGKDTAPAAGPQRPGTDPSAAVLGAAEKTAGTEPPRLP
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PAPAPPSGALRPHPSPLLHRSALYQALRPFRLAATDPWQHSYDAEETARGYARRLLASPHPGGGHRPVAV
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TPQWAPFVRPGVQLTVLVDESVSMLFHQDQVNDFIGLVRSSGVFRGVRVERFTSDSADPAPVPAAGWGAS
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SGKDPGGIHIAVVLSDGIGEGWARGSVQSWLGCLAQRLPVAIIHLLDPRQWSRTGIRPAAMELTVAAHLG
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RAPANRHYTARPFQWPDGLPLPEPEFPHSALSVVLPVLASRPEMIHAWARFVMGTRQRTLNAGALRVVPG
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DTAANAAGERPTAAPTPEARVRRFRRDSSETAFQIAVDLAAVPLTEPVIAAVCQRFAGHPQPSELIEVLF
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SGLVTEVDSPVVTPERRIRWEYRRGVREALLSLGGRRSRIRRTLADIAAEFAGYDPWFALLRRILDDSPV
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GELPELDETSLRLAADTLPALESIGLADLHHGLVYRIKEQMLAHQGAGHPDDWSDTLLEIAPTGPLVPGS
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SGQHGTTASERVPHAPHPTETPSNSASDESSMMSQRSVSISDNFPGGSGSTGIGAGRNTSLSAIWGGDIP
00503741   1/1  ----------------------------------------------------------fifldlrplall
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           PRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQ
00503741   1/1  plpdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfgk
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----npfilgpkvdledfigreeelkeleeal......pk..ivlltGprGsGKTtllkalakel..gkp
00474201   1/1  -----deelelleklslllveklrpvllddlvgqeeakeallealr....agrpghvllvGppGtGKTtl
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  -----llveklrpvllddlvgqeeakealleala....agrpghvllvGppGtGKTtlaralanellrlg
00437921   1/1  -----lglllveklrpkllddvvgqeealerlllalk....agklphlllvGppGvGKTtlaralarlll
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  -----yeplveklrpvllddlvgqeeakealleala...ggrpprpvllvGppGtGKTtlaralanelgr
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsa
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           IHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT
00503741   1/1  vvyvnvselldlkellrlllealglpppyq..lsggerlrvalaeallalgkpdllilDEitnlldpetl
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  viyidlselsskgyvdleellrelaeelgellellkkllkklsellglsilglelilglsggdleellee
00474201   1/1  aralanelprslpglpfvrvnasdltdvglleellgkllgaat..................fllakpgvl
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  vlglpfvrvnasellealllsdlfgell........gallralfellr----------------------
00437921   1/1  gs...............gggvdvieldasdlrgvddlreligevlqalglllggkpdvlllDEidrldpd
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  pfvpvallcfvrvncaallelsasdll...........eselfge.ekeaflgallerlgklalagggtv
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  rrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrvalarallakpdvlllDEidgl
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLVGFSKHEAAELAEELGHMPIALRQAAAWMNDSATTIA
00503741   1/1  spdvlelLlrlleegkltdkllgltliltthdldllerladrllsrfngk--------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  laellkk..lgkpvililDEiqslldvsskelleaLlrlldegknvtiiltgsdlglldelllrpdlksp
00474201   1/1  flDEidkldpdvqnaLlrlleelpsnvrviattnrpleldpallsRflvielpppdleerleilklllek
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  aqna------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  lflDEidkldpdvqnaLlrlleeppsnvrvilttnrpekldpallsRflvielpppsleerleilk----
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  dpdvleallelleelkrsgvtvilttn............dldeleladria-------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           EYLEFYRDKQAQLAPMFAPADPDYPETVITALNVSLDRLAVTNPAALQLLQVCSFFSTAPIPRSLFRHAQ
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  lygRfdeiielkplsfe-----------------------------------------------------
00474201   1/1  lgle.lsde-------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ---------------------------------------------------vsaleldpdrfeallalgr
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           DVAAPPELEAALQEPNKLHRAFSDIGRYGLAVLNHRTRTVQVHRLVQQALRVPLTADDQEQRRHCAHLLL
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  allalgryeeAiaaleralalwpgda............................................
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           AKNDPQDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATLSVWRE
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ---------------------------------------------llynlgrtlieekdllealvsf..e
00526461   1/2  ---------------------------------------------------------------------p
00402511   1/2  -------------------------------------------------------------------iel
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  --------------------------------------------------------------------le
00472561   1/2  ---------------------------------------------------------------------e
00526701   1/3  ................lgdldealwllaealrlepdrleallnlaeallalgrydeAlaaleralal...
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ---------------------------------------------------------------------e
00516421   1/2  ---------------------------------------------------------------------e
00512401   1/3  ---------------------------------------------------------------------e


                         -         -         +         -         -         -         -:1190
query           KLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHD
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  -------------------------------------------------------------------yee
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ealelnPksvealynlgevlkelklyrdalelyeealeLsPenpevyvnvavvlleldrleeAillyeea
00526461   1/2  aeellekaleldpddaeallnlGnalfklgdyeeAielyekalelllkllgleellllddpdnle.....
00402511   1/2  lekaleldpdnaealkllGnalfklgdyeeAielyekalellpellealleealeldpdnaeaylnlala
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  -----------------------------------------------------------rallalgryee
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  -----------------------------------------------------ldpdnalallllgllll
00473661   1/2  kaieldpdlaevllnlalayyalgrydeAieclkkalel...............................
00472561   1/2  kaleldPdnaeawlnlGlallelgrleeAlaalekal.................................
00526701   1/3  .....dPlreralallglalyrlGrraeAlaayeralellpdelgvepgpelralye-------------
00456921   1/2  -------------------------------------------------kaleldpenaealknlGnalf
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  kaleldpdnaeayynlglallklgdyeeAlealekalel-------------------------------
00516421   1/2  kaleldpnnaealynlgllllklgryeeAleyyek-----------------------------------
00512401   1/3  ealkldpenlrealyylalayyklgdyekAlkylekale-------------------------------


                         *         -         -         -         -         +         -:1260
query           SVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  --------------------PenaealkelGnalfklgdyeeAielytkalel........dpdnaeayl
00429321   1/1  AielyekAlkllkksslflsllflsskpdyeeaaeaylkaGnaykllgeyeeAleayekalelyekl..g
00526462   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ---------------------------yllGlallklgdyeeAielyekalel........dpdnaeall
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  lelkPddvkaylnlglallllgqldeAvllydkalkl.ePgfleavlllssllaqlglldeallalesal
00526461   1/2  ......................................aeallnlglaylklgdyeeAledyekalel..
00402511   1/2  ylklgdyeeAiedyekalel.dpdnakalyrlglaylklgdyeeAledfekalel........dPdnaea
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  -----------sieaavssdpqlaeilkelGnalfkeGnyeeAillfqkalkilknyle...........
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  -------------------------------------------------------------dpdkaesly
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  AiaaleralalwpgdalgdldealwllaealrlepdrleallnlaeallalgrydeAlaaleralal...
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  elgelekaleayekal..lepndaealfnlawallkssnlgdyeeAielleeal........kldpenlr
00473661   1/2  ...................dpdnvkalynlalalyslgdyeeAieylrkaisl........nPdnieall
00472561   1/2  .................eldpdnaealynlglallalgdyeeAlealekale------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  klgdyeeAielytkalel.dpnnaeaylnlalaylklgdyeeAledyekalel........dpnnakayy
00392761   1/2  -------------------ePkdalaylllgllllklgdyeeAlelfekaleld........penaealf
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKD
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  nlalaylklgdyeeAledyekalel........dpdnakayynlglallklgryeeAleayekaleldpd
00429321   1/1  sdpdaaealynlgllykklgdyeeAieayekalelypkn..gdfsqaakallnlaelyeellgdyeeAle
00526462   2/2  ----------------------------------------------------------------paeell
00526703   3/3  ---------------------------------dpdrfeallalgrallalgryeeAiaaleralalwpg
00516422   2/2  nlglallklgdyeealeal................................glleeAieayekaleldpd
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  -------------------------------------iellekaleldpdnaealkllGnalfklgdyee
00472562   2/2  ----------------------AlaalekaleldpdnaeallnlGlallklgrleeAlaafekaleldPd
00503581   1/1  rvdPddvdalln..................................................latvlral
00526461   1/2  ......dpdnakalynlglallklgdyeeAlealekalel........dpdnaeallnl-----------
00402511   1/2  llnlgllllklgdyeeAiely-------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ................................idpedlklllelqptlllnlalahlklgeydeAvelfr
00456922   2/2  --------------------------------------ealknlGnalfklgdyeeAielytkaleldpn
00392762   2/2  ----------------------------------------ePkdalaylllgllllklgdyeeAlelfek
00464951   1/1  klgvalyelgdyeeAielfseaikikpk...........vlfllavayyklgkyeeAvkdldealkidps
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  --------------------------------ldpdnalallllgllllelgelekaleayekallepnd
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  .....dPlreralallglalyrlGr---------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ealyylalayyklgdyek----------------------------------------------------
00473661   1/2  llalvllklgeyseaeklil--------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  nlglallklgdyeeAledye--------------------------------------------------
00392761   1/2  nlalallklgdyedveeAiel-------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           RFGEDSMIAVVAAANHAAALRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEE
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  n........aealylnlglallklgryeeAleayekaleldpdnalayeealellekaleldpdnaeayy
00429321   1/1  yyekalelyes..egddplaaeallnladlyaklgdyeeAielyekalelapdn.sllkyglkdallnlg
00526462   2/2  ekaleldpddaeallnlGnalfklgdyeeAielyekalelllkllgleellllddpdnleaeallnlgla
00526703   3/3  dalgdldealwllaealrlepdrleallnlaeallalgrydeAlaaleralal........dPlrerala
00516422   2/2  n........aealynlglallklgkllglallalgdyeeAieayekalel........dpnnaealynlg
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  AielyekalellpellealleealeldpdnaeaylnlalaylklgdyeeAiedyekalel........dp
00472562   2/2  na........eawlnlGlallelgrleeAlaalekal........eldpdnaealynlglallalgdyee
00503581   1/1  grleeAetllekalrlepdyst........alenlgvlliqigeleeAlqayqraleldpndpkaylnlG
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  kalelqPnd........akaflrlglvllnlgdyeeAleyfkkalel........dpsdieavsllgkll
00456922   2/2  n........aeaylnlalaylklgdyeeAledyekalel........dpnnakayynlglallklgdyee
00392762   2/2  aleldpen........aealfnlalallklgdyedveeAiellekallk......eldpdnpealyylal
00464951   1/1  l........akaylnlGnallklgkyeeAikayekalkldpdnalalyqleaieikpdlalalnnlGlly
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ae.........alfnlawallkssnlgdyeeAielleeal........kldpenlrealyylalayyklg
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  --------------nlalayyalgrydeAieclkkalel........dpdnvkalynlalalyslgdyee
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           ARVIDERALQVLTDRLGEYHTSTLSSALNLASDFFGLDDVAESVRRDTETLARCRRALSERHPLTLLARR
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  nlglallklgdyeeAlealek-------------------------------------------------
00429321   1/1  lcylalgdyeeAlealekaleldpsfad------------------------------------------
00526462   2/2  ylklgdyeeAledyekalel........dpdnakalynlglallklgdyeeAlealekalel........
00526703   3/3  llglalyrlGrraeAlaayeralellpde-----------------------------------------
00516422   2/2  llllklg---------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  dnakalyrlgl-----------------------------------------------------------
00472562   2/2  Alealekale------------------------------------------------------------
00503581   1/1  lvlaklkeldeAlkvyreaLe-------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  lrlgdiveealkvleklle---------------------------------------------------
00456922   2/2  Aledyekalel-----------------------------------------------------------
00392762   2/2  alyklgdyee------------------------------------------------------------
00464951   1/1  lrlgdydeAie-----------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  dyekAlkylekale--------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  Aieylrkaisl........nPdnieallllalvllklgeyseaeklil----------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           NLVLGRKAMNEDVAEEIAAVERLYAEVMGDQHPATLSMRRRERGNADLHLNNL-----------------
00503741   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00429321   1/1  ----------------------------------------------------------------------
00526462   2/2  dpdnaeallnlallll------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00516422   2/2  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00402512   2/2  ----------------------------------------------------------------------
00472562   2/2  ----------------------------------------------------------------------
00503581   1/1  ----------------------------------------------------------------------
00526461   1/2  ----------------------------------------------------------------------
00402511   1/2  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00486991   1/1  ----------------------------------------------------------------------
00456922   2/2  ----------------------------------------------------------------------
00392762   2/2  ----------------------------------------------------------------------
00464951   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00472561   1/2  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00456921   1/2  ----------------------------------------------------------------------
00392761   1/2  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00516421   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------